KEGG   Campylobacter curvus: CCV52592_0696Help
Entry
CCV52592_0696     CDS       T00576                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ccv  Campylobacter curvus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ccv00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1280609..1281352
Genome map
AA seq 247 aa AA seqDB search
MKSYAKINIFLKIVGTRGDYHEILSRFVLLGELFDEINFEKASKFSLESNVNIENNIILK
AKNELARAGFANEIDEFFSSHKITLRKNIPMGAGLGGGSSNAASFLVMANESLNLKLSRE
RLCEIGSKIGADVAFFIHGFKAANVSGIGEKVEEFNDDVPSLEIFTPDVFCSTPEVYKKF
RSDFMQNINVKMANNFANLSSRELLENFKNYELNDLYAPCFALYPQLKIYRDKFLSGSGS
TTFEVKR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctatgcaaagataaatatctttttaaagatcgtcggcacacgcggcgattat
cacgaaattttatcgcgtttcgtgcttttaggcgagctctttgacgagataaattttgaa
aaagcatcaaaatttagcctagaaagcaacgtgaatatcgaaaacaacatcattttaaag
gccaaaaatgagcttgcgcgtgcgggatttgcaaacgagatagacgagtttttcagctcg
cacaagatcacgcttcgtaaaaatatcccaatgggcgcagggctgggaggtggcagctct
aatgcggctagttttttagtgatggcaaacgagagcctaaatttaaagctctcacgtgag
aggctttgcgagataggctcgaaaataggcgctgacgtagcattttttatccatggcttc
aaggctgcgaacgtgagcggtatcggcgaaaaggtagaggaatttaacgacgacgtgcca
agtcttgaaattttcactccggatgttttttgctctacacccgaggtttataagaaattt
agaagcgacttcatgcaaaacatcaacgtcaaaatggcgaataattttgcaaatttaagc
tcgcgcgagcttttggaaaatttcaaaaactacgagctgaacgacctttatgcaccctgc
tttgcgctatatccgcagcttaaaatttatagggataaattcctaagcggtagcgggagc
acgacatttgaggtgaaacgatga

DBGET integrated database retrieval system