KEGG   Campylobacter curvus: CCV52592_0948Help
Entry
CCV52592_0948     CDS       T00576                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ccv  Campylobacter curvus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCV52592_0948 (hemD)
Enzymes [BR:ccv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CCV52592_0948 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
540574..541218
Genome map
AA seq 214 aa AA seqDB search
MAEIYLVSNTPSNDESMINLPVSEIKFLKFSLNLDEFDALVATSKNSFKALEFNHIKIKP
DMQIYAIGEPCAKAAKRCGFSKIYTAKNSHGGEFAAEISPLLKGKKTLYLRAKSIVSNLG
EILKQNGILVSQIVAYESVCARLDKEKMPPENSVLIFSSPSNVKNFILNFGWLDSYKAVA
IGETTAKELAKFTDPLVSARQEINACVELAKTLL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatttatctcgtctcaaatactccctcaaatgatgagagcatgataaacctg
cctgtaagcgagataaaatttttaaaatttagtctaaatttagatgaatttgacgcgctc
gtggcgacctctaaaaactccttcaaagccttagaatttaatcatataaaaataaaaccg
gatatgcaaatttacgctatcggcgagccgtgcgccaaggctgccaagagatgtggtttt
agtaaaatttatactgctaaaaattctcacggaggcgaattcgccgctgaaatttcgcct
cttttaaaaggcaaaaagacgctttatctaagagctaaaagcatcgtttcaaatttaggc
gaaattttaaagcaaaacggcattttagtaagccagatcgtagcctatgagagcgtttgc
gccaggcttgacaaagaaaaaatgccgcctgaaaatagcgttttgatcttttcctctccg
tcaaacgttaaaaatttcatcctcaattttggctggcttgatagctacaaagccgtagcc
atcggtgaaacgacggcaaaagagctggcgaaatttacagatcccctcgtgagtgcgagg
caagaaataaatgcctgtgtagagcttgccaaaacgttactttaa

DBGET integrated database retrieval system