KEGG   Campylobacter curvus: CCV52592_0990Help
Entry
CCV52592_0990     CDS       T00576                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ccv  Campylobacter curvus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ccv01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ccv00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
504288..505385
Genome map
AA seq 365 aa AA seqDB search
MDVVAFFTEILKFRSITPDDDGCLKFIAEFLGDFEARFIEKNGVKNLILSKRFGDGAHLA
FAGHVDVVPPGEGWQSEPFTPLMKDGFIYARGAQDMKSGVAAFVCACRDAKNFNGRLTLI
LTSDEEGDALFGTLEALKILKERGELPQFAVVAEPTCTGVFGDTIKVGRRGSINGKILIR
GVQGHVAYPEKCVNPVHQIAPLLSRIAGHDMDAGSEFFSPSKIVITDIRGGMEVCNVTPS
ELGIMFNVRNSDITSADDVKNYLQSVLEGLNFELSLKQSSKPFLTDKDSKIVRAMSKAVQ
KISGVAPQLNTKGGTSDARYLAEFGVKVVEFGVINDRIHAVDERAGVKEVERLYLVFKEL
IENFA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgtagcgttttttactgaaattttgaaatttcgctccatcacgcctgatgat
gacggatgtttgaaatttatagcggaatttctcggcgatttcgaggctcgttttatagaa
aaaaacggcgttaaaaatttgatattaagtaaaagatttggcgatggggcgcaccttgcc
tttgcggggcatgtcgatgtcgtgccaccgggggagggctggcagagcgagccgtttaca
cccttgatgaaagatggcttcatctacgcgcgtggcgcacaggatatgaaaagcggcgta
gcggcctttgtctgcgcttgccgtgatgctaaaaattttaacggcaggctcactctcatt
ttgactagcgacgaagagggcgatgcgctctttgggacgttagaggcgctcaaaatttta
aaagagcgcggcgagctgccacagtttgcagtcgtcgccgagcctacgtgtacgggagtt
tttggtgatacgataaaggtcggcaggcgtggctctataaacggcaaaattttgatacga
ggcgtgcaaggacacgttgcatatcctgaaaaatgcgtaaatcccgtgcatcaaatagct
cctcttttatctaggatcgctggtcatgacatggacgcgggaagtgagtttttctccccc
agcaagatcgttatcacggatattcgcggcggcatggaggtctgtaatgtcacgccaagc
gagctaggcataatgtttaacgtgcgaaattcagatatcacgagtgcggatgacgtgaaa
aactatctgcaaagcgtgcttgaggggttaaatttcgagcttagtctaaagcaaagctcg
aagccttttttgaccgacaaagacagcaaaatcgtgcgtgcgatgagtaaagcggtgcaa
aaaataagcggcgtagcaccacagctaaacaccaaaggcggcactagcgacgcgagatat
ctagccgaatttggcgtgaaagtcgtagaatttggcgttataaacgaccgaatacacgca
gtcgatgaaagagccggcgtaaaagaggtcgagcggctttatcttgtatttaaagagctg
atcgaaaattttgcatag

DBGET integrated database retrieval system