KEGG   Campylobacter curvus: CCV52592_1247Help
Entry
CCV52592_1247     CDS       T00576                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ccv  Campylobacter curvus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCV52592_1247 (tpiA)
   01230 Biosynthesis of amino acids
    CCV52592_1247 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCV52592_1247 (tpiA)
   00051 Fructose and mannose metabolism
    CCV52592_1247 (tpiA)
   00562 Inositol phosphate metabolism
    CCV52592_1247 (tpiA)
Enzymes [BR:ccv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CCV52592_1247 (tpiA)
Exosome [BR:ccv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CCV52592_1247 (tpiA)
  Exosomal proteins of bladder cancer cells
   CCV52592_1247 (tpiA)
  Exosomal proteins of melanoma cells
   CCV52592_1247 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395925..396614
Genome map
AA seq 229 aa AA seqDB search
MKFLANLKCNHTRASFAEYAKILDANLSADDDVSVFVPFTAFDAKEHKFKLGAQNFYPCV
SGAFTGEIGKAQLDEFGISSVLIGHSERREILGESERLLRAKFDFAAKNGWQIIYCVGEN
LSVNEAGGTKEFLRTQLGNIDTGYANLIVAYEPIWAIGTGKSASAEQIAEILGFLRTLTL
APLLYGGSVNAANIGEIARIRECGGVLVGTASWDATNFLNLIASSRERI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatttctagcgaatttaaagtgcaaccatacccgagcgagctttgccgagtatgcg
aaaattttggatgcaaatttaagcgcagatgacgatgtgagcgtgtttgtgccatttact
gcatttgatgcgaaggagcataaatttaagcttggagcgcagaatttttatccttgcgtt
agcggggcatttaccggcgagatcggtaaggcgcagctggatgaatttggcatttcaagc
gtgcttatcgggcactccgaaagacgcgaaattttaggcgagagcgagcggcttttgcgt
gctaaatttgacttcgcggctaaaaacggctggcagatcatctactgcgtgggcgaaaat
ttaagcgtaaatgaagctggtggcacaaaggaatttttacgcacgcagcttggaaacatc
gatactggctacgcaaatttgatcgtcgcgtatgagcctatttgggcgattggcacgggc
aaaagcgcgagcgcggagcaaatcgctgaaattttaggatttcttcgcactttaactcta
gcaccgctactttatggcggcagcgtaaatgccgcaaatatcggtgagatcgcgcgtata
agggagtgtggcggagtgctggtggggactgcgagctgggatgcaacaaatttcttaaat
ctcatcgcgtcgtctcgtgagcgtatttaa

DBGET integrated database retrieval system