KEGG   Campylobacter curvus: CCV52592_1256Help
Entry
CCV52592_1256     CDS       T00576                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ccv  Campylobacter curvus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CCV52592_1256 (gmk)
Enzymes [BR:ccv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CCV52592_1256 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
387896..388507
Genome map
AA seq 203 aa AA seqDB search
MQGQILVVSGPSGSGKSTLLSRLLKEESDLCFSISSTTRAIRDGEKEGVDYYFISEDEFK
KGIENGEFLEWAQVHKNFYGTSLKPVLSALNEGKIVIFDIDVQGFHIALEKFKSYITSIF
ITTTNKKELKKRLQNRGTDNAETIENRLMNAVGEMEHILEYDYFLINDDIEKSYRGLKSV
VHAMRLKSANINLRQTVDSWIDC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggggcaaattttagtcgtttcagggcctagtggtagcggcaagagcacgctttta
agcaggcttttgaaagaagaaagtgatctgtgcttttctatctcaagtacgacaagagcg
atcagagacggcgaaaaagagggcgtggattattattttataagcgaggatgagtttaaa
aaaggcatagaaaacggagaattcctagaatgggcgcaggtgcataaaaatttttacggc
actagcctaaagcccgttttgagcgcgctaaatgagggcaagatcgtgatctttgacatc
gatgtgcagggctttcatatagcgcttgaaaagtttaaaagttatatcacgtcgattttc
atcacgactacaaataaaaaagagcttaaaaaacgtttgcaaaatcgtggcacagacaat
gctgaaacgatagaaaaccgcctaatgaacgcagtcggtgagatggagcatatcttagag
tatgattattttttgataaatgacgacatagaaaagagctatcgcgggctaaaatctgtg
gtgcacgcgatgaggctaaagagtgcaaatataaatttacgtcaaaccgttgatagctgg
atagactgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system