KEGG   Campylobacter curvus: CCV52592_1332Help
Entry
CCV52592_1332     CDS       T00576                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ccv  Campylobacter curvus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCV52592_1332
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CCV52592_1332
Enzymes [BR:ccv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CCV52592_1332
Two-component system [BR:ccv02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CCV52592_1332
Bacterial motility proteins [BR:ccv02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CCV52592_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679568..680131
Genome map
AA seq 187 aa AA seqDB search
MAQKLVLIGASTGGPGHIKKLLKNIDLKGASIVIAQHMNKMFIPSFATQIGRECEINVEI
LNDRAVLKDRVYICEQNFMIGDSVPLNAKPNIETKTIYTPNVDMLFNSGVSVCKSANVMA
ILLTGIGDDGASGLNNLYKAGARCIAESEDSAIVYGMPKRAKELNPNLKSLNLFAARKEL
EDFLNAF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaaaagctagtattgataggcgcatctacgggcggaccaggtcatataaaaaaa
ctcctcaaaaacatcgatctaaaaggcgcaagcatagtcattgcgcagcatatgaataag
atgtttatcccgtcttttgcgacgcaaataggcagagaatgcgagataaatgttgaaatt
ttaaacgatagggcggtcctaaaagacagggtatatatctgcgagcaaaatttcatgata
ggcgatagcgtgccgctaaatgcaaaaccaaatatcgaaactaaaaccatatacacgcca
aatgtcgatatgcttttcaactctggcgtgagcgtatgcaagagcgcaaacgtgatggcg
atactgctgactggtataggtgatgatggcgcgagcggactaaacaacctttataaagcg
ggtgctagatgtatcgccgagagcgaggacagcgcgatagtttatggtatgccaaaacgc
gccaaggagctaaatccaaatttaaaatcgctaaatttatttgccgccagaaaagagctc
gaggactttttaaatgctttttaa

DBGET integrated database retrieval system