KEGG   Campylobacter curvus: CCV52592_1348Help
Entry
CCV52592_1348     CDS       T00576                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ccv  Campylobacter curvus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCV52592_1348 (hemB)
Enzymes [BR:ccv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CCV52592_1348 (hemB)
Exosome [BR:ccv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCV52592_1348 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1415082..1416059)
Genome map
AA seq 325 aa AA seqDB search
MFKRFRRLRINPLFRDLIRETSLSVNDFIYPLFVVEGRGVKKEIASMPGVFQMSVDEILK
ECAAVINLGIKAVILFGIPSVKDSVGSDALSDEGIIAVTLRAIKDKFPNLLVVTDLCFCE
YTDHGHCGILDHVHQTVDNDATLEISAAQALVHAKNGADMIAPSGMMDGIIATLRGALDE
NGFENLPIMAYSTKFASAYYGPFRDVAESAPSFGDRRSYQMDSANRLEAVSESLEDEAQG
ADVLMVKPALAYLDIIRELREATRLPICAYNVSGEYALLKAGAKAGVIDYERVMMETLVG
FKRAGADIIISYHAKEAAEILRRNF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacgttttagaagacttaggataaatccgctgtttagggacctcataagggag
acgagcctaagtgtgaacgacttcatctatccgctttttgtcgtggagggcaggggcgtg
aaaaaggagatcgcctcgatgccgggtgtctttcagatgagtgtggatgaaattttaaaa
gagtgcgcggcggtcataaatttaggcataaaggcggtgattttatttggcataccaagc
gtgaaagatagcgtaggctccgatgctttgagcgacgagggcattatcgccgtcacgctt
cgagctataaaggataaatttccaaatttactggttgtaaccgatctgtgcttttgcgaa
tacaccgaccacggacactgcggcatcctagatcacgtccatcagacggtcgataacgac
gcgacgctggaaatctccgccgcgcaggctctcgtgcatgctaaaaacggcgcggatatg
atcgcgccaagcggcatgatggacggtatcatcgccacacttcgcggtgcgctcgatgag
aatggctttgaaaatttaccgataatggcgtattcgacgaaatttgcgtcggcttactac
ggaccttttcgcgatgtggcggagagtgcgcctagctttggcgaccgcaggagctatcag
atggatagcgcaaaccgcctggaagccgtgagcgagagcctagaagacgaggcgcagggg
gcggatgttttgatggtaaagcccgcgttagcataccttgatatcatccgcgagctacga
gaggcgacgagactaccgatatgcgcgtataacgtgagcggagaatacgcacttttaaaa
gcgggcgcaaaagctggcgtcatcgactatgagcgcgtgatgatggagacgctcgtgggc
tttaagcgcgcgggagctgacatcatcatcagctatcacgccaaagaggcggcggaaatt
ttgaggcgaaatttttaa

DBGET integrated database retrieval system