KEGG   Campylobacter curvus: CCV52592_1358Help
Entry
CCV52592_1358     CDS       T00576                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ccv  Campylobacter curvus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CCV52592_1358 (recR)
DNA repair and recombination proteins [BR:ccv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CCV52592_1358 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(520146..520718)
Genome map
AA seq 190 aa AA seqDB search
MKKGLEKFNELVDAFGKLPGVGKKSAARFAYFVSMQDSFAGLRLAQCIEDAARFIKRCER
CGGLSENEICDICADEARDKSMIAIVESPRDILVFEQNGIYEGLYFVLDEIDDGAINRLK
SMIELNKATEIIFAFTPGLNTDALMLYVEDKLGMSELKFSKIAQGVPTGVSLENVDMLSL
LKALESRTKA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtctagagaaatttaacgagctagtcgatgcttttggcaagcttcctggc
gtaggtaaaaaatcagccgccagattcgcctactttgtaagcatgcaagacagcttcgcg
gggctcagactggctcagtgcatcgaggatgcggccaggtttataaagcgctgcgagaga
tgtggcgggcttagcgaaaatgaaatttgcgacatttgcgccgacgaagcgcgagataaa
agcatgatagccatcgtcgaaagccctagagatatcttggtcttcgagcaaaacgggatc
tacgaagggctttatttcgtgcttgacgagatagatgatggcgctataaataggctaaaa
agcatgatcgagctaaataaagccaccgagatcatatttgcctttacgccgggccttaac
actgacgccttgatgctttacgtcgaggataagcttggcatgagtgagctgaaatttagc
aagatcgcccaaggcgtacctaccggggtcagcctcgaaaatgtcgatatgctctcgctt
ttaaaagcacttgagagccgcactaaggcttaa

DBGET integrated database retrieval system