KEGG   Campylobacter curvus: CCV52592_1483Help
Entry
CCV52592_1483     CDS       T00576                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ccv  Campylobacter curvus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
122740..123639
Genome map
AA seq 299 aa AA seqDB search
MQKLFFSLLLVIDIFAAEASFEPLLFLNYDESRAHLGKKLFFDKRLSSNENYSCETCHNL
YWDFSGTNSKYVQKGTLNPPSILNAASNYIFYNDGRIRGIHAQVKESITSRYELNSGEDK
ILTAVKDIEEYEILFARIYKDGITYENIVDAFVEFEKAILTINSPFDRYLAGDESALGEG
EKKGFEIFKNLGCVACHNGKNLGANLMQDVRFSKDILAGVSSQSDMNKRLYRVPSLRNIA
VSAPYLMDGSIMTLKEAIKHIGANQFMYDLSGDEIDALYKFLLSLSGERPRIMNEPSSN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcttttcttttcgctacttttggtgatcgacatttttgctgcagaggcgtcc
ttcgagccgctactgtttttaaactacgatgagagcagagcgcaccttggcaaaaagctc
tttttcgacaagaggctaagcagcaacgaaaactactcgtgcgagacctgtcacaacctc
tactgggactttagcggaacgaattcaaaatacgtccaaaagggcactctaaacccgcct
agcatattaaacgcagcgtcaaattatatattttacaacgacggtcgtatccgcggcatc
catgctcaagtaaaagagtccatcacctcgcgctatgagctaaattccggtgaagataaa
attttaaccgccgtaaaagacatcgaggaatatgaaattttattcgcgcgcatctacaaa
gacggcataacttatgaaaatatagtcgatgccttcgtagaattcgaaaaggcgatactg
acgataaattcgccctttgatagatatctggcgggcgatgagagcgcgcttggcgagggc
gagaaaaagggatttgaaatttttaaaaatttaggctgcgtagcgtgccataacggtaaa
aatttaggtgcgaatttgatgcaggacgtgcgattttcaaaggatatattagccggcgtc
tcctctcaaagcgatatgaataagcgcctttaccgcgtgccgtcacttagaaatatcgcc
gtaagcgcaccttatttgatggacggcagcataatgacgctaaaagaggcgataaaacat
atcggcgcaaatcagtttatgtatgatctaagcggcgacgagatcgatgcgctctataaa
ttcctactttctttaagcggcgaacgcccgaggataatgaatgaaccttcgtcaaattaa

DBGET integrated database retrieval system