KEGG   Campylobacter curvus: CCV52592_1567Help
Entry
CCV52592_1567     CDS       T00576                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ccv  Campylobacter curvus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCV52592_1567
Enzymes [BR:ccv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CCV52592_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
734288..735430
Genome map
AA seq 380 aa AA seqDB search
MKFYRINENSDFDAICKRIAPSVGGLKLMSKKSHINFIFIDDIGSPAANILKQDALSAGA
ELVTNKDTIFGCEERSSALLMGTDAQFEILSKKEKMQDFGLKNLADFLNQNFKKPHEAQI
MGVLNINEDSFNAASRVDAKNAVSRIEAMIEEGACYIDIGGVSSRPGSEYCGREEEFRRI
ERVVAEIYRLNLHERAKFSLDSFDEYCLEYALDHGFAMINDITANVNLASLVARYDAEFC
MMHMQNDPKTMQLAPHYEDLLGEMDAFFADKIAKASELGAKKLVLDVGIGFGKTAEQNLL
LIKHLGHFLHFGYPLLVGASRKSVINFYSPSEVSQRLPGSLYLHLKAHENGATIIRTHDV
VEHAQMFALQNAMNEVNLWK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattttataggataaacgaaaattcggactttgacgccatttgtaagcgcatagcc
ccaagcgttggcgggctgaagctgatgtctaaaaaatctcacataaattttatctttata
gatgacatcggctctccggcggcaaatatcctaaagcaagacgcgctaagtgcgggggcc
gagctggttacgaacaaagatacgatatttgggtgcgaggagcgaagcagcgcgcttttg
atgggcacggacgcgcagtttgaaattttaagcaaaaaagaaaagatgcaggattttggc
ttgaaaaatttggctgattttttaaaccaaaattttaaaaaaccgcacgaggcgcagata
atgggcgtcctaaacatcaacgaagatagcttcaatgccgcaagccgcgtagatgctaaa
aacgccgtatcgaggatcgaggcgatgatagaagagggggcttgctacatcgatatcggc
ggagtgagctccaggccaggcagcgagtattgcggccgcgaggaggagtttaggcgcata
gagcgcgtcgtggctgaaatttaccgcctaaatttacacgaaagggcgaaatttagtctc
gatagctttgatgagtactgcctagaatacgcgctagatcacggctttgcgatgataaac
gacatcacggcaaacgtaaatttagcctccttagtggcacgctacgacgcggaattttgc
atgatgcatatgcaaaacgaccctaaaacgatgcagctagcgccgcattatgaggatctg
ctgggcgagatggacgccttttttgcggacaagatcgcaaaggcgagcgagcttggggct
aaaaagctcgtgcttgatgttggtatcggctttggaaaaacggcagagcaaaatttgcta
cttatcaagcatttggggcatttcttgcactttggctatccgcttttggtaggcgcgagc
aggaagtccgtgataaatttttacagcccaagcgaggtgagccagcgactgccgggtagc
ctttatctacatctaaaggctcacgaaaacggcgcgacgatcatccgcacgcacgacgtg
gtggagcatgcgcagatgtttgcgctacaaaatgcgatgaacgaggtaaatttatggaag
tga

DBGET integrated database retrieval system