KEGG   Campylobacter curvus: CCV52592_1687Help
Entry
CCV52592_1687     CDS       T00576                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccv  Campylobacter curvus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCV52592_1687
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCV52592_1687
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCV52592_1687
Enzymes [BR:ccv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCV52592_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1604329..1605078)
Genome map
AA seq 249 aa AA seqDB search
MDKIARAFEGKKANIGYIVAGYPSLEHTKEFLLNLDASSLDLLELGIPYSDPLADGKLIA
QASFETAAKGVNTDTIFEILDEVKADVKKPIVFLVYYNIVFAYGVEKFIKRSGEVGISGF
IIPDLPFEECEEVRSLCDKFKLDLIPLISVTSAGRADKILSVGSGFIYALGAIGVSGSQR
ASEERLKSLVASLKQKSDLPVAVGFGVKNAQDANLVKSYADGAIIGTQIVKLTAKFSGDE
LVSQIEKLF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggataagatcgcgcgcgcatttgagggcaaaaaggcaaacatcggctacatcgtggca
ggctacccaagcttagagcacacgaaggagtttttgttaaatttagacgccagctcgctt
gacctattggagcttggcataccatactccgacccgctagcagacggcaagctcatcgcc
caggctagctttgagaccgcggcaaagggcgtaaataccgatacgatctttgaaattttg
gacgaggtcaaggcggatgtgaaaaagccgatcgtttttttggtgtattacaacatcgtc
tttgcttatggcgtggagaaatttatcaagcgttccggcgaggtcggcatcagcggcttt
atcatccccgatctgccctttgaagagtgcgaggaggtacgctcgctgtgcgataaattt
aagcttgatctcatcccgctcatcagcgtgacgtcagccggcagagcggataaaatttta
agtgtgggctcaggcttcatctacgcgctgggggctatcggcgtgagcgggtcgcaaaga
gccagcgaggagcggctaaaaagcctagtcgctagcttaaagcaaaaaagcgatctgccc
gtggctgtgggctttggcgtgaaaaatgcgcaagacgcaaatttagtcaaatcctacgcc
gacggtgcgatcatcggcacgcagatcgtaaagctcacggctaaatttagcggagacgag
ctagttagccagatagaaaagcttttttga

DBGET integrated database retrieval system