KEGG   Campylobacter curvus: CCV52592_1846Help
Entry
CCV52592_1846     CDS       T00576                                 

Definition
(GenBank) putative protein, putative aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ccv  Campylobacter curvus
Pathway
ccv00051  Fructose and mannose metabolism
ccv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CCV52592_1846
Enzymes [BR:ccv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CCV52592_1846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: EAU00262
UniProt: A7GYX7
Position
1159754..1160341
Genome map
AA seq 195 aa AA seqDB search
MELRHSINELKKISLSMFRKNFFGVFHGSISARIERNQFLINKQNAIFDDLRDDDLTLLF
SKKDYRWNEASLDADIHLNIYKNINEAKFVCYAMPPYTTAYAMRQDKITPKDYFGYMRFN
EISVYDPKQFEDWYERAETEIYRYMIEKSTNIVVIKGYGVYAFSRTPQQLAKEIAILENS
CRLLHFENYYSDFSI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggagctaagacactcgataaacgaacttaaaaaaatatccctttcgatgttccgtaag
aattttttcggtgtatttcacggctctatttcggccaggatagaacgaaatcaatttctc
ataaataagcaaaatgcaatatttgacgatcttagagacgacgatctgaccttgcttttt
tcaaaaaaagactaccgctggaatgaagccagcctcgatgcggacattcatttaaacata
tacaaaaatataaacgaggcgaaattcgtatgttacgcgatgccgccgtatacgaccgca
tatgctatgaggcaagataagatcacgcctaaagattattttggatatatgagatttaat
gaaatttcagtttatgatccaaagcagtttgaggactggtatgagcgtgccgagactgaa
atttaccgctatatgatcgaaaaaagcacaaatatcgtagtcataaaaggatacggagta
tacgcatttagtcgcactcctcagcagctggcaaaagagatagccatacttgaaaacagc
tgcaggcttttgcattttgaaaattattatagtgactttagcatataa

DBGET integrated database retrieval system