KEGG   Campylobacter curvus: CCV52592_1952Help
Entry
CCV52592_1952     CDS       T00576                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ccv  Campylobacter curvus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ccv01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ccv00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1093714..1094499)
Genome map
AA seq 261 aa AA seqDB search
MILDEIIKRTKEDLKKRKSDYPAQWLGRSLAYNPYVPRDVASALSSSAKEPLRIIAEVKK
ASPSKGVIRENFEPIRIAKEYEDAGANAISVLTEPHWFKGDIEYITQIRRYTATPLLRKD
FIVDEYQILEALVYGADFILLIAKALSSKELKGLLAYAHHLGLEVLVETHDAQDVKKAIF
AGANIIGINHRNLDDFSMDMSLCERLIPLLPNGKIIVAESGLYEHEQLKELNRIGVDAFL
IGEHFMRQEDIKTAVKNIKEG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgatgagatcataaaaaggacgaaagaggatctaaaaaagcgcaaaagtgac
tatcctgcgcagtggttaggcagatcgctggcgtataatccttacgttccaagagacgtg
gcaagcgcgttaagctcaagcgctaaagagccgcttcgtatcatcgccgaggtcaaaaag
gcaagcccgagcaaaggtgtgatacgtgaaaattttgagcctataaggatagcaaaagag
tatgaagatgccggagcgaatgcgatcagcgtgcttaccgagccgcattggtttaaaggc
gacatagagtatatcacgcagatacgccgctacacagccacgccgcttttaagaaaagat
ttcatcgtagacgagtatcaaattttagaagctttagtgtatggagccgacttcatacta
ctcatcgcaaaggcgctttctagcaaggagctaaaaggactgctagcttacgcgcatcat
ctggggcttgaggtcttagtcgagactcacgacgctcaggatgtgaaaaaagcgatcttt
gcaggtgcaaatataatcggcatcaatcacaggaatttagatgattttagcatggatatg
agcctttgcgagaggctgataccgcttttgccaaacggcaagataatagtcgccgaaagc
ggtctatacgagcacgagcagcttaaagagttaaacaggatcggcgtcgatgctttcttg
atcggggagcatttcatgaggcaagaagatataaaaactgccgtcaaaaatataaaggag
ggctag

DBGET integrated database retrieval system