KEGG   Campylobacter curvus: CCV52592_2091Help
Entry
CCV52592_2091     CDS       T00576                                 

Gene name
pcm
Definition
(GenBank) L-isoaspartate protein carboxylmethyltransferase, type II
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ccv  Campylobacter curvus
Brite
Enzymes [BR:ccv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CCV52592_2091 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_32 Ala_racemase_N NodS Methyltransf_23 Methyltransf_4 MTS CMAS Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: EAU00863
UniProt: A7H161
Position
1941902..1942537
Genome map
AA seq 211 aa AA seqDB search
MTSLEEIKCQNLADEIADEITLAPAVYKAIATTEREIFVPIKTHAYKLDAQPILGNQWIS
SPLTVAKMTLALECDKGIDNVLEIGCGSGYQAAILGKLAHRVFSVERIEKLATEAKKRFE
ALKIRNVHVRYDDGNNGWKSYAPFDRILISAATDKVGQNLFNQLKNGGILVAPIKKHEKQ
FIVKFKKDESGNISESVFDECLFVPLLSGRE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttgacatccctcgaagagataaaatgccagaatttagccgatgagatcgcagacgagatc
acgctcgcaccggccgtttataaagccatcgcaacgacagagagagaaattttcgttccg
ataaaaacgcacgcctataagctggacgcgcagccgatcttgggcaatcaatggatcagc
tcgccactaaccgtggcaaagatgacgcttgcgctagagtgcgacaaaggcatcgacaac
gtgctagagatcggctgtggcagcggctatcaggcggccatacttggcaagctggcgcat
agggtatttagcgtagagcgcatagaaaagctggctacggaggccaaaaaacgcttcgaa
gcgctaaagatacgtaacgtgcatgtgcgctacgacgacggtaacaacggctggaagagc
tatgcaccatttgaccgcatcctgatatcggcggccactgataaggtcggacaaaatctc
ttcaaccagctcaaaaacggtggcattttggtcgctccgatcaaaaaacatgagaagcaa
ttcatcgtgaaatttaaaaaagacgagagcggcaatatcagcgagagcgtatttgacgag
tgtttgttcgtgccacttctaagcggacgagagtag

DBGET integrated database retrieval system