KEGG   Campylobacter curvus: CCV52592_2201Help
Entry
CCV52592_2201     CDS       T00576                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccv  Campylobacter curvus
Pathway
ccv00040  Pentose and glucuronate interconversions
ccv00052  Galactose metabolism
ccv00500  Starch and sucrose metabolism
ccv00520  Amino sugar and nucleotide sugar metabolism
ccv01100  Metabolic pathways
ccv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CCV52592_2201 (galU)
   00052 Galactose metabolism
    CCV52592_2201 (galU)
   00500 Starch and sucrose metabolism
    CCV52592_2201 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CCV52592_2201 (galU)
Enzymes [BR:ccv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CCV52592_2201 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABS50423
UniProt: A7GZR5
Position
complement(1451948..1452778)
Genome map
AA seq 276 aa AA seqDB search
MIQTCLFPAAGYGTRFLPATKSLPKEMLPILTKPLVHYGVDEALEAGMNNMAFVTGRGKR
ALEDYFDISYELEHQIAGTSKEPLLDDIRKLMDSCTFSFTRQNEMRGLGHAIYTGKTLVR
DEAFGVVLADDLCVNDAGEGVLAQMVKIYEKYRCSVVAVMEVPKEQIKSYGVVSGRFIED
DLIMVDDMVEKPDPADAPTNLAIIGRYILTPDIFNILERTKPGKNGEIQITDALRSQAKE
GIVIAYKFKGRRFDCGSIDGFVEATNFFYELKNGRK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaacctgcctatttccggctgccggatacggaacgagattcttaccggcgaca
aaatcactaccaaaagagatgttaccgatcctgacaaagcccttggtgcattacggagtc
gatgaggccttggaggcggggatgaacaatatggcctttgttacgggacgcggcaagcgc
gctttggaggattattttgatatcagctacgaactggagcatcaaatagccggcaccagc
aaagagccgctgcttgatgacatcagaaagctcatggactcatgcactttcagctttacc
cgccaaaacgagatgagagggcttgggcatgctatctatacgggcaagacgctcgttcgc
gacgaggcttttggcgtggtgctcgcggacgatctttgcgtgaacgacgcaggcgagggc
gtgctcgcgcagatggtaaaaatttatgaaaaataccgctgctcggtagttgcggtgatg
gaagtgccaaaagagcagataaaatcctacggcgtggtgagcggccgcttcatagaagat
gatctcataatggtcgatgatatggtagaaaagcccgatcctgccgatgctccgacaaat
ttagccatcatcggacgatatatattgacgcctgatatctttaatatattagagcgcaca
aagcccggtaaaaacggcgaaattcagataacggacgctctaagatcacaggctaaagag
ggcatcgtgatagcttataaattcaagggcaggcgctttgactgcggcagtatagacggc
tttgtagaggctacgaatttcttttacgagctaaaaaatggtagaaaatag

DBGET integrated database retrieval system