KEGG   Corvus cornix (hooded crow): 104683290Help
Entry
104683290         CDS       T03546                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X4
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ccw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    104683290 (MGLL)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104683290 (MGLL)
Peptidases [BR:ccw01002]
 Serine Peptidases
  Family S33
   104683290 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 311 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQYLFCRYWKPAASPRALVFIAHGAG
EHCGRYDDLAQKLTGLNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKEHP
ELPVLILGHSMGGAISILTASERPSEFSGMLLISPLVVASPEVATPIKVFAAKVLNFVLP
NLSLGSIDPNAISRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAIARIERALPKLTLPIL
VLHGSSDKLCDIRGSYLLMDTVQSQDKTLKVYEEAYHALHKELPEVSTSVFTEILTWIGQ
KVSAAGETSHT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcttccagaatgccagaggaaagttcaccaaagcggagtcctcaa
aacatcccatacaaagatctgccccatatcatcaatgctgatgggcagtatctcttctgc
aggtattggaagccagcagcatctcccagggccctcgtgtttatcgcccatggcgctggg
gagcactgcggccgctatgatgacttggcccagaagctgacaggacttaacttgtttgtg
tttgcccatgaccatgttggccatgggcagagcgagggtgatcgtatggttgtctcagat
ttccacgtcttcatcagggacagcttgcagcacattgatctcatgaagaaagagcaccct
gagctgcccgttctcatcctggggcactccatggggggagccatctccattctgacagct
agtgagcgacccagtgagttttcaggcatgctgttaatctctcctttagtggtagccagc
ccagaagtcgctactcccatcaaggtttttgcagcgaaagtgctcaactttgtgctccca
aacctgtccctgggatcaatagatccaaatgcaatttcccggaacaagaaagagatggag
tcttacacatctgatcccttggtctaccacggtggcatgaaggtctccttcgtcatccag
ctgatgaacgccattgccagaattgaacgagccctgcccaagctgactttgcccatcctg
gtgctacacggctcttccgacaagctctgcgatatcaggggctcctatttactgatggac
acagtgcagagtcaggacaaaaccctcaaggtgtatgaggaagcctatcatgccctccac
aaagagctgcccgaggtctctacctccgtcttcacagaaatactgacatggattggccag
aaggtctcagcagctggggaaaccagccatacttaa

DBGET integrated database retrieval system