KEGG   Corvus cornix (hooded crow): 104696651Help
Entry
104696651         CDS       T03546                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ccw  Corvus cornix (hooded crow)
Brite
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104696651 (ABHD12)
Peptidases [BR:ccw01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   104696651 (ABHD12)
Exosome [BR:ccw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104696651 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 361 aa AA seqDB search
CLHFSTYTRFYQEKSCLLDKSFALVTLRYGLWFRLRKLLLWLLGMYIAIPFLVKLCPAIQ
AKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAALWKNARGKDQ
LWFEEALGSSHPVILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSIGSPSE
RGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTN
IREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDENVKYISCSLLILHAEDDPVVP
FHLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYIYRSPELPRILREFLGKSEHEHH
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
tgcctgcacttcagcacatatactcggttttatcaggagaaaagctgtctgctggataaa
agctttgccctggttacattgcgatatggattatggtttcgattgaggaagttactactc
tggttgctgggaatgtacatagccatcccatttctagtaaaactgtgccctgctatccag
gcaaagctggtcttcctaaactttgtgagggtcccatatttcattgacttgaaaagacca
caggatcaaggtttaaaccacacctgtaattattacttgcagccagaggaggatgtaacc
attggagtctggcacacggtccctgcagccttatggaagaatgcccgagggaaggaccag
ctgtggtttgaagaggctttgggctccagccatcccgtaatcctttacctgcacgggaat
gcgggaacaagaggaggggatcaccgggtggagctctacaaggttctcagctccctcggg
taccatgtggtgacgtttgactatcgaggctggggtgactcaataggcagcccgtcagag
aggggaatgacctacgacgcccttcacgtctttgactggataaaagcacgaagtggagac
aaccctgtctatatatggggacactccctgggcacaggggttgcgacgaatctggtgcgg
cgcctttgcgagagagaaacgcccccggatgccctgatcctggaatctccattcaccaac
atacgggaggaggcacggagtcaccccttttctgtgatatacagatacttccctgggttt
gactggttcttccttgaccccatcacgacaagcggaattaaatttgcaaacgatgagaat
gtgaaatacatttcctgctctctgctcatccttcatgctgaggatgatccagtggtacca
tttcacctgggaaaaaagctttacaacatcgcggccacgtcgcggagtttccgggactac
aaggtgcagtttgtgcccttccacacagacctcggctaccggcacaagtacatctacagg
agtccagagctacctcggatacttcgggaattcctgggaaaatctgaacatgagcatcat
cactga

DBGET integrated database retrieval system