KEGG   Corallococcus coralloides: COCOR_00177Help
Entry
COCOR_00177       CDS       T01780                                 

Gene name
mauG
Definition
di-heme cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ccx  Corallococcus coralloides
Brite
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     COCOR_00177 (mauG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(208599..209762)
Genome map
AA seq 387 aa AA seqDB search
MTGFRPRTAVLALALLGAGCESEVPFPTEDELDQLSALHTQSVKPEADPTNKWADNADAA
VLGQRLFEDPGLSRCGTVSCKSCHAGESYTVETATAEGCGGHQSERNPPSLLNVGYSRWF
MWDGRADRLWSQAVLPLTNPIEMDSDATVVRARLAGEPTYTAAYTQLFGKAPADESDPNR
LMANVGKVLAAYQRTLNRTDAPFDADVRRFLQAVEAGTQEKDPAYLGLKTFVRKGQCVVC
HKGRSLSDDKFHNLGLKDTGAGRRGQADVVDALMSWQFNAAGPYSDAPSGIDAARLSTLK
AQAQTKPTEVEGAFRTPTLRNVALSAPYMHTGAEKTLEDVVDFYNEGGDPDGTFPGVRTE
TIVKLDLSSEEKQALVTLLKSMTGVAK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgactggtttccgtccgcgtaccgccgtgctcgccctggccctgctgggggcgggttgc
gaatccgaagttccctttccgaccgaagacgagctggaccagctgagcgccctgcacacg
cagagcgtgaagccggaggcggaccccaccaacaagtgggcggacaacgcggacgcggcg
gtgctgggccagcggctgttcgaggacccggggctgtcgcgctgcgggacggtgtcctgc
aagagctgccacgcgggtgagtcctacacggtggagacggcgacggcggagggctgcgga
ggccaccagtccgagcgcaacccgcccagcctgttgaacgtgggctacagccgctggttc
atgtgggacggacgggcggaccggctctggtcgcaggcggtgctgccgctgacgaacccc
atcgagatggactcggacgcgacggtggtgcgcgcgcggctggccggggagcccacgtac
acggcggcgtacacgcagctgttcggcaaggcgcccgcggacgagtcggacccgaaccgg
ctgatggcgaacgtgggcaaggtgctggcggcgtaccagcgcacgctcaaccgcaccgac
gcgcccttcgacgcggacgtgcggcgcttcctgcaggcggtggaggcgggcacgcaggag
aaggacccggcgtacctgggcctgaagacgttcgtgcgcaagggccagtgcgtggtgtgc
cacaagggccgctcgctgtcggacgacaagttccacaacctggggctgaaggacacgggg
gcggggcggcgcgggcaggcggacgtggtggacgcgctgatgtcctggcagttcaacgcc
gcgggcccctacagcgacgcgccgtcgggcatcgacgcggcgcggctgtccacgctgaag
gcgcaggcgcagacgaagcccacggaggtggagggcgcgttccgcacgcccacgctgcgc
aacgtggcgctgagcgcgccgtacatgcacaccggcgcggagaagacgctggaggacgtg
gtcgacttctacaacgagggcggcgacccggacggcaccttccccggcgtgcgcacggag
accatcgtcaagctggacctgagcagcgaggagaagcaggcgctggtgacgctgctcaag
tccatgacgggcgtggcgaagtag

DBGET integrated database retrieval system