KEGG   Corallococcus coralloides: COCOR_00332Help
Entry
COCOR_00332       CDS       T01780                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
ccx  Corallococcus coralloides
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    COCOR_00332 (pfkB)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     COCOR_00332 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(390042..390998)
Genome map
AA seq 318 aa AA seqDB search
MRLTKPGVVTVTLNAAIDQTLECPGFTAGAVNRVVAETRTPGGKGINVAAFLAGGTRPVT
ATGFLGEDTVPLFETLFRERGIQDRCLRLPGSSRVNIKVVDRTGGAVTDLNLPGLRVPEE
ALGALMATLDALAEENGCFVLSGSVPAGVPASIYATLTERLRARGAVVAVDTSGAPLRHA
VAAKPDFVKPNAHELEELVERPLRNAGDIARAARELHATGIGLVVVSLGADGALFVSNDG
AWRALPPPVEVASTVGAGDALVAGVLASRLEGHDLETCARRSTAFAAAKLAKVGPVPPAP
ERVAELLCAVRMHPLGTG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctgacgaagccgggcgtggtgacggtcacgttgaacgcggccatcgaccagacg
ctggagtgtcctgggttcacggcgggcgcggtgaaccgcgtggtggcggagacgcgcacg
ccgggaggcaagggcatcaacgtggcggcgttcctcgcgggaggcacgaggccggtgacg
gccacgggcttcctgggcgaggacacggtgccgctgttcgagacgctgttccgcgagcgg
ggcatccaggaccgctgcctccggctgccgggctccagccgcgtgaacatcaaggtcgtg
gaccgcacgggcggcgcggtgacggacctgaacctgccgggcctgcgcgtgccggaggag
gccctgggcgcgctgatggcgacgttggatgcgctcgcggaggagaacggctgcttcgtg
ctgtccggcagcgtgccggcgggagtgcccgcgtccatctacgccacgctgacggagcgc
ctgcgagccaggggcgcggtggtggcggtggacacgagcggagcgccgctgcgccacgcg
gtggccgcgaagccggacttcgtgaagcccaacgcgcacgaactggaagagctggtcgaa
cgccccctgaggaacgcgggcgacatcgcgcgagccgcacgcgagctgcacgcgacaggc
atcgggctggtggtggtgtcgctgggagcggacggcgccctcttcgtatcgaacgacggc
gcctggcgggccctgccgccccccgtggaggtggcgagcacggtgggcgcgggcgacgcg
ctggttgccggagtgctggcctcgcggctggaaggccacgacctggagacctgcgcccgg
aggagcacggccttcgcggcggcgaagctcgcgaaggtcggcccggtgccacccgcaccc
gagcgcgtggcggagctgctctgcgcggtgcggatgcacccgctgggcacgggctga

DBGET integrated database retrieval system