KEGG   Corallococcus coralloides: COCOR_00427Help
Entry
COCOR_00427       CDS       T01780                                 

Gene name
adh3
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ccx  Corallococcus coralloides
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    COCOR_00427 (adh3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_00427 (adh3)
  Lipid metabolism
   00071 Fatty acid degradation
    COCOR_00427 (adh3)
  Amino acid metabolism
   00350 Tyrosine metabolism
    COCOR_00427 (adh3)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    COCOR_00427 (adh3)
   00626 Naphthalene degradation
    COCOR_00427 (adh3)
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     COCOR_00427 (adh3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
506750..507751
Genome map
AA seq 333 aa AA seqDB search
MAATMRAMVLHAPGQRLRQEERPLPEPGPEQVLLKVHACAVCRTDLHVVDGELTRPKLPL
VPGHEIVATVVATGAKVEGLTAGLRVGVPWLGWSCGQCRFCRSGRENLCDTARFTGYDID
GGFAEYTVADARFCFPLPPSYRDVEAAPLMCAGLIGFRSLRMAGDGPRLGLYGFGAAAHI
LIQVARHQGRRVHAFTREGDAKGQAFARELGAVWAGGSDTPPPEPLDAAILFAPVGALVP
AALKAVDKGGVVVCGGIHMSDIPSFPYSVLWEERVVRSVANLTRQDAMDFLALAPRVPVR
TEVQMFPLSAANEALQALREGRVRGAAVLDMAE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccatgcgggcgatggtgctccacgcacccggacagcgcctgcggcaggag
gagcggccccttccggagcccgggccggagcaggtgctgttgaaggtgcacgcctgcgcg
gtgtgccgcacggacctgcacgtggtggacggagagctgacgcgcccgaagctgccgctg
gtgccgggccacgaaatcgtggccacggtggtggcgacgggcgcgaaggtggagggcctg
accgcagggctgcgcgtgggggttccgtggctgggatggagctgcgggcagtgccgcttc
tgccgctccggccgggagaacctctgcgacacggcgcgcttcaccggctacgacatcgac
gggggcttcgcggagtacaccgtcgcggatgcgcgcttctgcttcccactgccgccgtcg
taccgcgacgtggaggccgcgccgctgatgtgcgcggggctcatcggcttccgcagcctg
cgcatggcgggagacggcccccggctggggctgtatggctttggcgccgccgcgcacatc
ctcatccaggtggcgcggcaccaggggcgccgcgtgcatgccttcacgcgcgagggtgac
gccaagggccaggccttcgcgcgggagctgggcgcggtgtgggcgggaggctcggacacg
ccgccgccggagccgctggacgcggccatcctcttcgctcccgtgggcgcgctggtgccc
gcggcgctgaaggccgtggacaagggcggcgtggtggtgtgcggcggcatccacatgagc
gacatcccgtcctttccctattcggtgttgtgggaggagcgcgtggtgcgctcggtggcg
aacctcacgcggcaggacgcgatggacttcctggcgttggcgccgcgagtgccggtgcgc
acggaggtccagatgtttcccctgtccgccgcgaacgaagcgctccaggccctgcgcgaa
ggccgcgtgcgaggggccgcggtcctggacatggcggagtag

DBGET integrated database retrieval system