KEGG   Corallococcus coralloides: COCOR_00599Help
Entry
COCOR_00599       CDS       T01780                                 

Gene name
rbsK
Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COCOR_00599 (rbsK)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     COCOR_00599 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AFE10086
UniProt: H8MES5
Position
709857..710801
Genome map
AA seq 314 aa AA seqDB search
MSPRIAVVGGVATDYLVRGPSFPEPGGSAEGDVFQEALGGKGANGAVAAVRLGARASLVA
RVGSDGRGLRQVTSLEREGVALEGVVPDPGAPSGAVLVMVDGDGRKQTFFSPGANHRLSI
RDVLRSAERIATAKVLLVQLEVPLDAVQAAVRLARAAGVRVVLDPAPAVPLPEVLLEDVH
VIRPNAAEARALTGIPVHGRASARRAARNLLMRGVGAAIIAAPGGSLLVSKEEEAWLPEL
PVDTVDTTGAGDAFSAALCVALAEGQPLLTAARFAHAAAAIATTRLGAQAGLPYRDEVLG
LLADVKPDVQFAPP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgcatcgcggtggtgggaggcgtggccacggactacctggtgcgcgggccg
tcgtttccggagccgggaggcagcgccgagggcgacgtcttccaggaggcgctcggagga
aagggggccaacggcgcggtggccgccgtgaggctgggggcgcgtgcctcgctggtggcg
cgggtggggtcggatggacgcggcttgaggcaggtgacgtcgctggagcgggaaggcgtc
gcgttggagggggtggtgcctgatccgggtgcaccctcgggggcggtgctggtgatggtg
gatggagacgggaggaagcagaccttcttctcaccgggcgccaatcacagactttccatc
cgggatgtgttgcggagcgcggagcggatcgccaccgcgaaggtgttgctcgtgcagttg
gaggtgccgctggacgcggtccaggcagcggtccgtctggcgcgagcggccggtgtccgg
gtggtgttggatcccgcgccggccgtgccgctgccggaggtgttgctggaggacgtgcac
gtcatccggcccaacgccgccgaggcccgggcgctgacaggcatcccggtgcatggccgt
gcttccgcgcggcgagccgcccgcaacctgctgatgcgcggagtgggagcggccatcatc
gcggcgcccggtggcagtctgctggtgtcgaaggaggaggaggcgtggctgcctgagctg
ccggtggacacggtggataccaccggagcgggggatgcgttctccgcggcgctatgtgtc
gccctggctgaaggccagccgctcctcaccgccgcgcgcttcgcgcacgccgccgccgcc
atcgcaacgacacggctgggagcgcaggcgggactgccgtaccgggatgaagtgctcgga
ctgctcgcggacgtaaagccagacgtccaatttgcgccgccgtag

DBGET integrated database retrieval system