KEGG   Corallococcus coralloides: COCOR_00599Help
Entry
COCOR_00599       CDS       T01780                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ccx  Corallococcus coralloides
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COCOR_00599 (rbsK)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     COCOR_00599 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709857..710801
Genome map
AA seq 314 aa AA seqDB search
MSPRIAVVGGVATDYLVRGPSFPEPGGSAEGDVFQEALGGKGANGAVAAVRLGARASLVA
RVGSDGRGLRQVTSLEREGVALEGVVPDPGAPSGAVLVMVDGDGRKQTFFSPGANHRLSI
RDVLRSAERIATAKVLLVQLEVPLDAVQAAVRLARAAGVRVVLDPAPAVPLPEVLLEDVH
VIRPNAAEARALTGIPVHGRASARRAARNLLMRGVGAAIIAAPGGSLLVSKEEEAWLPEL
PVDTVDTTGAGDAFSAALCVALAEGQPLLTAARFAHAAAAIATTRLGAQAGLPYRDEVLG
LLADVKPDVQFAPP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgcatcgcggtggtgggaggcgtggccacggactacctggtgcgcgggccg
tcgtttccggagccgggaggcagcgccgagggcgacgtcttccaggaggcgctcggagga
aagggggccaacggcgcggtggccgccgtgaggctgggggcgcgtgcctcgctggtggcg
cgggtggggtcggatggacgcggcttgaggcaggtgacgtcgctggagcgggaaggcgtc
gcgttggagggggtggtgcctgatccgggtgcaccctcgggggcggtgctggtgatggtg
gatggagacgggaggaagcagaccttcttctcaccgggcgccaatcacagactttccatc
cgggatgtgttgcggagcgcggagcggatcgccaccgcgaaggtgttgctcgtgcagttg
gaggtgccgctggacgcggtccaggcagcggtccgtctggcgcgagcggccggtgtccgg
gtggtgttggatcccgcgccggccgtgccgctgccggaggtgttgctggaggacgtgcac
gtcatccggcccaacgccgccgaggcccgggcgctgacaggcatcccggtgcatggccgt
gcttccgcgcggcgagccgcccgcaacctgctgatgcgcggagtgggagcggccatcatc
gcggcgcccggtggcagtctgctggtgtcgaaggaggaggaggcgtggctgcctgagctg
ccggtggacacggtggataccaccggagcgggggatgcgttctccgcggcgctatgtgtc
gccctggctgaaggccagccgctcctcaccgccgcgcgcttcgcgcacgccgccgccgcc
atcgcaacgacacggctgggagcgcaggcgggactgccgtaccgggatgaagtgctcgga
ctgctcgcggacgtaaagccagacgtccaatttgcgccgccgtag

DBGET integrated database retrieval system