KEGG   Corallococcus coralloides: COCOR_00608Help
Entry
COCOR_00608       CDS       T01780                                 

Gene name
cheR
Definition
CheR methyltransferase SAM-binding domain-containing protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ccx  Corallococcus coralloides
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ccx02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ccx02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(720458..722392)
Genome map
AA seq 644 aa AA seqDB search
MATKPPRDSELEAILEKVRQVRNFDFRNYKRATLQRRIERRMQATRCRSRTAYLALLERD
PTEVSTLVSSMLIKLTSFFRDKEVWQALEQSVAELVRQRPDAELRIWSAGCATGEEAYSL
AIIAAEAMGPGYPGAELKVFGTDVDEDAIATARRGIYSPEQLENVSPERLARFFVRTGNS
FTVRKEIRRAVVFGVNNLVSDAPVSRIDIILCRNVFIYLDSELQKRVLARFQFALRRNGL
MVLGRSELIPFAARLFRPIDLARRIYRRDGQAEVTSTTQDRLPPEPSSLPRILEPSMDFE
RSFLRNLLDSHPCPHIATDNDGTVTLWSRAAARLWNRNEGEMLGKKLATLGLPGLSGDLL
VEQSQRVRSGNSEREVADGLMEISNGDPVALRIQVVPLREAAGGRQGLLYIVHDISHLRG
MEQNLRAAQEELQAMQLRMQSSTEELRASNEELETTNEELQSANEELQTTNEELQSTNEE
LETTNEELQSANSELDATNRELAHRTLEMDALTFCQRTIIRTLSAAVLVLDGDGRITTWN
LAAERLLGLTERETVGQLLWSLHVPALKRALLLKLRRHLKEKRSLRMESIPYQLPHGGKG
SATLVATPLITDTHVLGSIILFEDTTRATALLEENRSLQEKLKA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaagcctccacgagacagcgagctcgaagccatcctggagaaggtccggcag
gtgcggaatttcgacttccgcaattacaagcgggccacgttgcaacggcgtatcgagcgg
cggatgcaggccacacgctgccggagccggacggcctacctggcgctgctggagcgggac
cccaccgaggtgagcacgctcgtctcttcgatgctcatcaagctgacgagcttcttccgg
gacaaggaggtctggcaggcgctggagcagagcgtggcggagctcgtgcgccagcggccg
gacgcggagctgcgcatctggagcgcgggctgcgccaccggcgaggaggcgtactcgctg
gccatcatcgcggcggaggcgatggggccgggctatcccggcgcggagctgaaggtgttc
ggcacggacgtggacgaggacgccatcgccaccgcgcgccggggcatctattcgccggag
cagctggagaacgtctcgccggagcggctggcgcgcttcttcgtgcgcaccggcaacagc
ttcacggtgcgcaaggagatccgccgcgcggtggtgttcggcgtgaacaacctggtgtcg
gacgcgccggtgtcgcgcatcgacatcatcctgtgccgcaacgtcttcatctacctggac
tcggagctgcagaagcgggtgctggcgcgcttccagttcgcgctgcgccgcaacggcctg
atggtgttgggacgctcggagctcatccccttcgcggcccggctcttccggcccatcgac
ctggcccggcgcatctaccgcagggacggtcaggcggaggtgaccagcaccacgcaggac
cggctgccaccggaaccctcgtccctgccacgcatccttgaacccagcatggacttcgag
cgctccttcctgcgcaacctcctggactcgcatccctgtccgcacatcgccacggacaat
gacggcacggtgacgctgtggagccgcgcggcggcccggctgtggaaccgcaacgagggc
gagatgctgggcaagaagctggccacgctgggcctgcctggcctcagcggtgacctgctc
gtcgagcagagccagcgcgtgcgctccggcaactccgagcgggaggtggccgacgggctg
atggagatctccaacggagaccccgtcgccctgcgcatccaggtggtgcccctgcgcgag
gcggcgggaggccggcagggcctgctgtacatcgtccacgacatctcccacctgcgcggc
atggagcagaacctgcgcgcggcgcaggaggagctgcaggccatgcagctgcggatgcag
tcctccacggaggagctgcgcgcgtccaacgaggagctggagacgaccaacgaggagctc
cagtccgcgaacgaggagctgcagacgaccaacgaggagctccagtccaccaacgaggag
ctggagacgaccaacgaggagctgcagtccgccaactcggagctggacgccaccaaccgc
gagctggcgcaccgcacgctggagatggacgcgctcaccttctgccagcgcaccatcatc
cgcaccctctccgccgcggtgctggtgctggatggtgacggccgcatcaccacctggaac
ctggccgcggagcggctcctgggcctcaccgagcgcgaaacggtgggccagctgctgtgg
tccctgcacgtgcccgcgctcaagcgcgcgctgctgctcaagctgcgccgccacctgaag
gagaagcgctcgctgcgcatggagagcatcccctaccagctgccgcacgggggcaagggc
agcgccaccctggtggccacgccgctcatcaccgacacgcacgtgctgggctccatcatc
ctcttcgaggacaccacccgggccaccgccctcctggaggagaaccggagcctgcaggag
aagctcaaggcatga

DBGET integrated database retrieval system