KEGG   Corallococcus coralloides: COCOR_00984Help
Entry
COCOR_00984       CDS       T01780                                 

Gene name
glkA
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ccx  Corallococcus coralloides
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCOR_00984 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_00984 (glkA)
   00052 Galactose metabolism
    COCOR_00984 (glkA)
   00500 Starch and sucrose metabolism
    COCOR_00984 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    COCOR_00984 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    COCOR_00984 (glkA)
   00524 Butirosin and neomycin biosynthesis
    COCOR_00984 (glkA)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     COCOR_00984 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1189115..1190128
Genome map
AA seq 337 aa AA seqDB search
MANASAKNGNGARNDKARIWGGIDLGGTKIEAVIVDARGDVLGRARHPTPPTGGPGEVVK
ELYGTLGEAAQSVGIEPGKLAGVGVGVPGSVDANKGTLSHTANVAGGWDAPYPLASDLGD
LVGGKVMLGNDVQVAVAAEYKLGAGRGHRSVLGVWWGTGVGGGLVLNGVPWRGQGSAGEI
GHMVVKPNGARCGCGRRGCLEAYAGRACMERKARSAAKKGEKTLLFDIMRDKKRTRLSSS
VWASALKQKDPLATRLIERAIEMMGVAIASVINLLDLEAVVIGGGLGSRLGPLYMGHLQD
AMHPHLFITERKPAMRIAELGDLSGAIGAALLAGPQM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcgtcagcgaagaacgggaacggggcgcgcaacgacaaggcccgcatctgg
ggaggcatcgacctgggcggcacgaagatcgaggccgtcatcgtggacgcgcgcggcgac
gtgctgggccgggcccgccatccaacacccccgacgggcggcccgggcgaggtggtgaag
gagctctacggcaccctgggcgaggccgcgcagtccgtgggcatcgagcccgggaagctc
gcgggcgtgggcgtgggcgtgccgggctcggtggacgcgaacaaaggcacgctctcgcac
acggccaacgtggcgggcggctgggacgcgccgtatccgctggcgtcggacctgggcgac
ctggtgggcggcaaggtgatgctgggcaacgacgtccaggtggcggtcgcggccgagtac
aagctgggcgcgggccgcggccaccgctccgtgctgggcgtgtggtggggcacgggtgtg
ggcgggggcctggtgctcaacggcgtgccgtggcgcgggcagggctccgccggcgagatt
ggccacatggtggtgaagcccaacggcgcacgctgtggctgcggccggcgcggctgcctg
gaggcctacgcggggcgcgcgtgcatggagcgcaaggcgcgctcggcggcgaagaagggg
gaaaagaccctcctcttcgacatcatgcgcgacaagaagcgcacgcgcctgtccagcagc
gtctgggcgagcgcgctgaagcagaaggacccgctggcgacgcggctcatcgagcgggcc
atcgaaatgatgggcgtggccatcgcctccgtcatcaacctgctggacctggaggccgtc
gtcatcggaggcgggctggggtcccggctgggccccctgtacatgggccacctccaggac
gccatgcacccgcacctgttcatcacggagcgcaagcccgcgatgcgcatcgccgagctg
ggggacctgtccggcgccattggcgcggcgctgctcgcgggcccgcagatgtaa

DBGET integrated database retrieval system