KEGG   Corallococcus coralloides: COCOR_01279Help
Entry
COCOR_01279       CDS       T01780                                 

Gene name
phoD
Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ccx  Corallococcus coralloides
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ccx00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ccx00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ccx02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535226..1537445
Genome map
AA seq 739 aa AA seqDB search
MFRVEGGATLDFADREPLHPCFPLESIALFNPFKRRTFLQAVVAVAATTTFGCSDDDSTD
ASDGSPYFPQSLASGDPRPDSVVLWVRVEDKDRAGDNLPLRLEVSPTEDFKTLVLDKKDL
SALAEHDHAVKVKVTGLSARTTYYYRFSYEKDGQKHTTRTGRTRTAPAAGDDVPVKFVFA
SCQDFIGRYYNAWQRLLQLDADLDFVVFLGDYVYETTGDTSFQSGDGGRAVRFSAPEEAL
PQGTGLTAFLAANSLSNYRDLYKTTRTDRQLQGVHERYPFIIVWDDHEFSDDCWQDVATY
EDGKRDETQLTRKLNAEQAFLEYIPLDTVQSGAGAIDVASEPRFPHSRIYRDFEYGKHLK
LLVTDYRSYRPDHLIPEDAYPGGVVLDETLLGAALQDQPDAVKQTFQTDTFAYVNIDDAA
YANQKQVLQGVYLSQAKAAGLTDAEAAQKAGQWVAGPVALYYVNQVLAAVNKGLVIPPAG
KPRGLAYAHMGKAALFNIQGSRYVVVKDTFDLFAAVKFKMTAGKSEDVFGPAQEEWFNQT
LTTAQNTWKMVVSSTSLSALIWDFRQQADISDPTLRQRFYFSVDQWDGFPTKKKVMLNAL
KAGVTNTLFISGDIHASFASVEEGVPTLTAPAITSGSIKSLASLALIGAGYATGAPVYQH
AVVEMEKTLQASNPGLRFADADSHGFVLMEVKADETLATFHLIPAGEVAKDYSKRADSEL
EAKFTAKTFRVKNSDIQPA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtgtggagggaggagcgactctagacttcgcggaccgggagccccttcacccc
tgcttcccgctggagtccatcgccttgttcaaccccttcaaacgccgcacgttcctgcaa
gccgtggttgctgtcgcggcgacgacgacctttggatgctccgacgacgactcgacggac
gcgtcggatggctcgccctacttcccgcagtcgctggcgtcgggggatccgcgtccggac
agcgtggtgttgtgggtgcgcgtggaggacaaggaccgcgccggggacaacctgcccttg
cggctggaggtctccccgacggaggacttcaagacgctggtgctggacaagaaggacctg
tcggcgctggcggagcatgaccacgcggtgaaggtgaaggtcaccgggctgtccgcgcgc
acgacgtactactaccgcttctcctacgagaaggacggccagaagcacaccacgcgcacc
gggcgcacgcgcaccgcgcccgcggcgggggatgacgtgccggtgaagttcgtcttcgcc
agctgccaggacttcattggccgctactacaacgcctggcagcggctgttgcagctggac
gcggacctggacttcgtcgtgttcctgggcgactacgtctacgagacgacgggcgacacg
tccttccagtccggcgacggcggccgggccgtgcgcttcagcgcgccagaggaagcgctg
ccgcagggcacgggcctcaccgcgttcctggcggcgaactcgctgtccaactaccgcgac
ctctacaagacgacccgcacggaccggcagctgcagggcgtgcacgagcgctacccgttc
atcatcgtctgggacgaccacgagttctccgacgactgctggcaggacgtggccacgtac
gaggacggcaagcgggacgagacgcagctcacccgcaagctcaacgcggagcaggccttc
ctcgagtacatcccgctggacacggtgcagtccggcgcgggtgccatcgacgtggccagc
gagccgcgcttcccccactcgcgcatctaccgtgacttcgagtacggcaagcacctgaag
ctgctggtgacggactaccgcagctaccggccggaccacctcatcccggaggacgcctat
ccgggcggcgtggtgctggacgagacgctgctgggcgcggcgctccaggaccagccggac
gcggtgaagcagacgttccagacggacacgttcgcgtacgtgaacatcgacgacgcggcg
tacgcgaaccagaagcaggtgctccagggcgtgtacctgagccaggcgaaggcggcgggc
ctgacggacgcggaggccgcgcagaaggccggccagtgggtggccggtccggtggcgctc
tactacgtgaaccaggtgctggcggcggtgaacaagggcctggtgattccgcccgcgggc
aagccccggggcctggcgtacgcgcacatgggcaaggcggcgctcttcaacatccagggc
tcgcgctacgtggtggtgaaggacaccttcgacctgttcgcggcggtgaagttcaagatg
accgccggcaagagcgaggacgtgttcggcccggcccaggaggagtggttcaaccagacg
ctcaccacggcgcagaacacctggaagatggtggtgagctccacgtcgctgtcggcgctc
atctgggacttccggcagcaggcggacatcagcgacccgacgctgcgccagcgcttctac
ttcagcgtggaccagtgggacggcttccccacgaagaagaaggtgatgctcaacgcgctc
aaggcgggcgtgacgaacacgctgttcatctccggggacatccacgcgtcgttcgcgtcg
gtggaggagggcgtgcccacgctgacggcgccggccatcacctccggctccatcaagagc
ctggccagcctggcgctgattggcgcgggctacgccacgggcgcgccggtgtaccagcac
gccgtcgtggagatggagaagacgctccaggcgtccaaccccggcctgcgcttcgcggac
gcggactcgcacggcttcgtgttgatggaggtgaaggcggacgagacgctcgccaccttc
cacctcatccccgccggagaggtggccaaggactactccaagcgcgcggacagcgagctg
gaggcgaagttcaccgcgaagaccttccgcgtgaagaacagcgacatccagccggcctga

DBGET integrated database retrieval system