KEGG   Corallococcus coralloides: COCOR_01327Help
Entry
COCOR_01327       CDS       T01780                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccx  Corallococcus coralloides
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    COCOR_01327 (galU)
   00052 Galactose metabolism
    COCOR_01327 (galU)
   00500 Starch and sucrose metabolism
    COCOR_01327 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    COCOR_01327 (galU)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     COCOR_01327 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1603497..1604399
Genome map
AA seq 300 aa AA seqDB search
MSSTDTKAAKLIRKCVIPAAGLGTRFLPATKAVPKEMLPIVDTPTLQYIVEEAVKAGMED
VVVINGRGKGSIEDHFDIAFELETTMRARGKTADADRMRAIANLVRIISVRQKEPLGLGH
AVLCAKSVIGDEPFGVLLGDDMIDSEDPGIGQLARIYQQHQKAVIALMEVPESETHMYGI
AAGKDLGNGVIQIDHVVEKPKKGTAPSNLAVIGRYVLPPSIFPILEKQTTGVGGEIQLTD
GLATLQKTEGLLGYKFQGQRYDAGDKVGYLKANIAYALKRPDLRGGLLEYLREVVKTEKP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaccgacacgaaggcagcgaagctcatccgcaagtgcgtcatccccgccgcc
ggcctgggcacccgtttcctcccggccaccaaggccgtgcccaaggagatgctgcccatc
gtcgacacgcccaccctccagtacatcgtggaggaggcggtgaaggccggcatggaggac
gtcgtcgtcatcaacggccgcggcaagggctccatcgaggaccacttcgacatcgcgttc
gagctggagaccacgatgcgtgcgcgcggcaagacggcggacgcggaccgcatgcgcgcc
atcgcgaacctggtgcgcatcatcagcgtgcgccagaaggagccgctcggcctgggccac
gcggtgctgtgcgccaagagcgtcatcggcgacgagcccttcggcgtcctcttgggcgac
gacatgatcgactcggaggatccgggcatcggtcagctggcgcgcatctaccagcagcac
cagaaggccgtcatcgcgctgatggaggtccctgagagcgagacgcacatgtacggcatc
gccgccggcaaggacctgggcaacggcgtcatccaaatcgaccacgtggtggagaagccc
aagaagggcaccgccccgtcgaacctggcggtgattggccgctacgtgctgcccccgtcc
atcttccccatcctggagaagcagaccacgggcgtgggcggtgaaatccagctcacggac
ggcctggccacgctccagaagaccgaaggtctgctgggctacaagttccagggccagcgc
tacgacgccggtgacaaggtgggttacctcaaggcgaacatcgcctatgcgctcaagcgc
cccgatctgcgcggagggctcctggagtacctgcgcgaggtcgtcaagacggagaagccg
tga

DBGET integrated database retrieval system