KEGG   Corallococcus coralloides: COCOR_01501Help
Entry
COCOR_01501       CDS       T01780                                 

Gene name
choD
Definition
GMC family oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ccx  Corallococcus coralloides
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    COCOR_01501 (choD)
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     COCOR_01501 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1797491..1799839
Genome map
AA seq 782 aa AA seqDB search
MRRLSSPLSELASHYPVVVVGSGYGGGITASRLSRAGQQVCVLERGREMHPGEMPRTPAQ
AVAEFQLHCAPGQGDLDVGSPTGLIEVHRNGDVSVIDGCGLGGTSLINAGVTMRPDPRVF
EDPRWPQALRADVHGLLEDGFAHAELMLRPLPYPEDHPPLQKLKTFGISAEKLGGRLTRP
PVAVTFEAGVNAAGVRQPGCSLCGDCATGCNTGAKNTVLMNYLPDAHAHGARIFTEVSVR
AVVPDGAKWRVYYRPLNTGRERFDAPDAWLTADRVVLAAGTMGTAEILLRSRELGLPVSS
KLGHRFSSNGDVLAFGYNLDMPVHGVGHGEQNHETRDPVGPCIAGVIDQRDTARLDEGMI
IEEGAIPGALASLMPAALAGAAALVGEDTDEGILDWVQERLRQADSFVRGPDHGAVEHTQ
TLMVMSHDEGKGELRLEHDRVRLHWPDAGRDPQLTRIEERLRRATAALGGTFVRYPLWSE
AFGKELLCTHPLGGCVMAERAEDGVVDHEGRVFSSASGHAVHEGLYVSDGSVVPRSLGIN
PLLTISAVAERACALMARRHGWTIDYAPLPEASAPQAPGPVGVRFTETMHGFLSGDVKAP
HLEAGDPERDDATPLRFVLTVTAEDLDATLRDERHPLTLTGTVTAPVLSSRPLVVTRGEL
RLMTREHARPGGQRMEYLLHLLSEAGEPYYLEGYKDLYDDPGLDLWKDTTTLFVSLHRGN
GPEAPCMGRGFLRLTAEEFARQLTTLRVLNARDGVQRAEALARFGGFFFGALWDTYVRRV
AA
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctgtcatccccgttgagcgagctggcatcccactaccccgtggtcgtcgtg
gggtcgggctatggcggaggcatcaccgccagccggctgtcgcgcgcggggcagcaggtg
tgcgtgctggagcgtggccgggagatgcacccgggggagatgcctcgcacgcccgcgcag
gcggtggccgagttccagctccactgcgctccgggccagggcgacctggacgtgggcagc
cccaccggcctcatcgaggtccaccgcaacggcgacgtgtccgtcatcgacggctgcggt
ctgggcgggacgtcactcatcaacgcgggcgtgacgatgcggcccgatcctcgcgtgttc
gaggacccccgctggccccaggccctgcgcgccgacgtgcacggcctgctggaggacggc
ttcgcgcacgcggagctgatgctgcggcccctgccgtacccggaggaccacccgccgctg
cagaagctcaagacgttcggcatctccgcggagaagctgggcgggcggctgacgcggcct
ccggtggcggtgacgttcgaggcgggcgtcaacgccgcgggcgtgcggcagccggggtgc
tcgctgtgcggtgactgcgccacgggctgcaacaccggcgcgaagaacaccgtgctgatg
aactacctgccggacgcgcacgcgcacggggcccgcatcttcaccgaggtgtcggtgcgc
gcggtggtgccggacggcgcgaagtggcgcgtctactaccgccccctcaacaccggccgc
gagcgcttcgacgcacccgatgcctggctcaccgcggaccgagtcgtcctggcggccggc
accatgggcacggcggagatcctcctgcgctcgcgcgagctcggccttccggtgtcctcg
aagctgggccaccgcttcagcagcaacggcgacgtgctggccttcggctacaacctggac
atgcccgtccacggcgtgggccacggcgagcagaatcatgagacgcgcgacccggtgggc
ccctgcatcgcgggcgtcatcgaccagcgcgacaccgcgcgcctggacgaagggatgatc
atcgaggagggcgccatcccgggcgcgctcgcgtcgctgatgcccgcggcgctcgcgggg
gccgcggcgctggtgggcgaggacaccgacgagggcatcctggactgggtccaggagcgg
ctgcgccaggcggacagcttcgtgcgcgggccggaccacggcgcggtggagcacacgcag
acgctgatggtgatgtcgcacgacgagggcaagggcgagctgcggctggagcacgaccgc
gtgcgcctgcactggccggacgccggtcgcgacccgcagctcacccgcatcgaggagcgc
ctgcgccgggccaccgccgcgctgggcggcaccttcgtgcgctacccgctctggtccgag
gcctttggcaaggagctcctgtgcacgcacccgctgggcggctgtgtcatggccgaacgg
gcggaggacggcgtggtggaccacgaggggcgcgtcttctccagtgcctccggccacgcg
gtgcatgaagggctgtacgtgtccgatggctccgtggtgcctcgctcgctgggcatcaac
ccgctgctcaccatctccgcggtggccgagcgcgcctgcgccctgatggcccgtcgccat
gggtggaccatcgactacgcgccgctgccggaggcctcggcgccccaggcccccgggccc
gtgggcgttcgcttcacggagacgatgcacggcttcctgtccggtgacgtgaaggccccg
cacctggaggccggcgacccggagcgcgacgacgccacgcctctgcgcttcgtgctcacc
gtgacggccgaggacctggacgcgacgctgcgcgacgagcgtcaccccttgacgttgacg
ggcacggtgacggcgccggtgctgtcgtcccgcccgctggtggtgacgcgcggcgagctg
cgtctgatgacccgtgagcatgcgcggccgggcggccagcggatggagtacctgctgcac
ctgctcagcgaggccggcgagccgtactacctggagggctacaaggacctctacgacgac
ccgggcctggacctgtggaaggacaccacgacgctgttcgtgtccctgcaccgggggaac
ggcccggaggcgccgtgcatgggccggggcttcctgcggctgacggcggaggagttcgcg
cgccagctcaccaccctgcgcgtgctcaacgcccgggacggcgtgcagcgggcggaggcc
ctggcccgcttcggcggcttcttcttcggcgccctctgggacacctacgtccggcgcgtg
gctgcctag

DBGET integrated database retrieval system