KEGG   Corallococcus coralloides: COCOR_01857Help
Entry
COCOR_01857       CDS       T01780                                 

Definition
(RefSeq) asparagine synthase
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ccx  Corallococcus coralloides
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCOR_01857
Enzymes [BR:ccx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     COCOR_01857
Peptidases [BR:ccx01002]
 Cysteine Peptidases
  Family C44
   COCOR_01857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2222645..2224207)
Genome map
AA seq 520 aa AA seqDB search
MLQADLAFDDLAGPLGLIEGGFSIGRSRVLLVQHRMLRTVLLEGAERIVAIVLERFADDP
EGLEHVVGATEGLIQEHLDGLEDYPLDFAALTIDRRRRAIRYTASPTISIPVYCLATGGR
ARFDWDYARLLGIGPHEIVWDYALALIAGISTYGPATMVSGLHRATAGATLVVTPAGVDA
VLPEPVRHDGPREMPPGVDVEALFRETVISILDARPLDSRRTAVELSGGMDSALTALATA
HVTGDGAMSMGAQFDGAMGEAQRARRLLLCRAGGFADLSLPAGRYAPFAPRSLRRRRYQV
SPEDENYPEIFEAAFHLLRSAGIDTLVSGFGGDELYFAYQGEAGEDGVAAEPPSCPFLSA
RGMATALSTRSTYPSAWLQQTSWQSAASQSQRLLRYGLWPVYPYLNVALARFVSRLPAAL
RRDRRILRRTLTQWLGDPVFETGYVKESFDPVARRGIAENRAYLRQLVEQSPLSRHREID
TAAILAALDSDIDRLDRATYNALFRFLKIACFFQSDRPLD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagccgatcttgcattcgacgacctggcaggcccccttggcctcatcgagggg
ggcttttccatcggccgctcgcgggtcttgctcgtgcagcatcggatgttgcggaccgtg
ctcctggagggcgccgagcggatcgtcgccattgtcctcgagcgcttcgccgacgatccg
gaagggctcgaacatgtcgtcggcgctacggaaggcctgatccaggaacacctcgacggc
ctcgaggactacccgcttgatttcgccgcgttgaccatcgaccgtcggcggcgggccatc
cgctacacggcgtcgccgacgatatcgatcccggtctattgcctcgcgaccgggggccgc
gctcgcttcgattgggactatgcccgcctgctcggcatcggcccccacgagatcgtctgg
gattacgcactcgccctgattgccggcatctccacctatggcccggcgacgatggtgtcg
gggctccatcgcgccacggcaggggcgaccctggtggtgaccccggcgggggtggatgcc
gtgctgccggagccagtgcgtcacgacggtccacgtgaaatgccgcccggcgtcgatgtc
gaggcgctgttccgtgaaacggtgatctcgatcctcgacgcacgccccctcgactcgcgg
cgaaccgcggtggagctgagcggggggatggactcggcgctgaccgccctggccaccgcg
cacgtgaccggcgacggcgcgatgagcatgggggcgcagttcgacggtgcgatgggggaa
gcgcaacgcgcgcgccgcctgctgttgtgccgcgctggcggcttcgccgacctgtcccta
ccggccgggcgctatgcccccttcgccccgcggagcttgcggcgacgccgctatcaggtg
tcgcctgaagatgaaaactacccggagatcttcgaagccgcatttcacctgctgcgctcc
gcggggatcgacacgcttgtctcgggattcggtggagacgaactctacttcgcctatcaa
ggtgaggccggggaggatggggtcgcagccgagcctccgtcgtgccccttcctctcagcc
cgcggcatggcgactgcgctcagcacgcgcagcacctatccgtcggcctggctgcaacag
accagctggcaaagtgccgcgagccaatcgcagcgcttgctgcggtacggcttgtggcct
gtctatccctatctgaacgtcgccctggcgcgatttgtctcacgcttgcccgccgcactc
cggcgcgaccgccgcatcctgcgccggacgctgacacagtggctgggcgatccggtgttc
gagacagggtacgtcaaggagagcttcgacccggtggcacgacgcggcatcgctgagaac
cgcgcctacctgcgacagctcgtcgaacagtctccgctatcgcgccatcgcgagatcgac
accgctgcgatcctcgcggcgctggacagcgacatcgaccggctggaccgggccacctac
aacgcgctgttccggttcctgaagatcgcctgtttcttccagtccgaccgcccgctcgac
tga

DBGET integrated database retrieval system