KEGG   Corallococcus coralloides: COCOR_02168Help
Entry
COCOR_02168       CDS       T01780                                 

Gene name
fadJ1
Definition
fatty oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ccx  Corallococcus coralloides
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCOR_02168 (fadJ1)
   01212 Fatty acid metabolism
    COCOR_02168 (fadJ1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    COCOR_02168 (fadJ1)
   00650 Butanoate metabolism
    COCOR_02168 (fadJ1)
  Lipid metabolism
   00071 Fatty acid degradation
    COCOR_02168 (fadJ1)
   01040 Biosynthesis of unsaturated fatty acids
    COCOR_02168 (fadJ1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_02168 (fadJ1)
   00310 Lysine degradation
    COCOR_02168 (fadJ1)
   00380 Tryptophan metabolism
    COCOR_02168 (fadJ1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCOR_02168 (fadJ1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    COCOR_02168 (fadJ1)
   00281 Geraniol degradation
    COCOR_02168 (fadJ1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    COCOR_02168 (fadJ1)
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     COCOR_02168 (fadJ1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     COCOR_02168 (fadJ1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     COCOR_02168 (fadJ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2606636..2608813)
Genome map
AA seq 725 aa AA seqDB search
MSEQNTLRWEQDADGIVVLTMDDPSQSANTMNAAYVKSMRAAVDRLVKEKDSITGVVITS
AKKTFFAGGDLNDLRNVKKDAASQVFNLGQEIKAQLRTLETLGKPVVAAINGAALGGGLE
IALACHHRILADVKGAVVGLPEVTLGLLPGGGGVVRTVRMLGITDALMKVLLQGQKYRPQ
EAKELGLVQEVVPSVDALLPAAKAWVKANPKAQQPWDQKGYKIPGGTPSHPAFAANLPAF
PANLRKQLKGTNMPAPRAIMAVAVESTQVDVDTAFTIESRYFTELVVGQVAKNMIQAFFF
DMQHINSGGGRPQGYPKHTAKKVGVLGAGMMGAGIAYVCAKAGIDVVLKDVSLAAAEKGK
GYSVKLVEKAVAKGSVTKEKGDALLARITPAEDPAALAGCDLVIEAVFEDVKLKHKVFQE
IQGVVAPDAVLGSNTSTLPITLLAEGVNRPPDFVGMHFFSPVDKMPLLELIAGKQTSDAT
LAKAIDIAVQIGKTPIVVNDSRGFFTSRVIGTFLNEAIAMVGEGIAPASIEQAGLQAGYP
AAPLQLVDELTLTLPRKIRQETKAAVEAAGQPWADHGSYAVMDAMIDQHGRKGRSTGGGF
YDYADGKRTNLWPGLKQHYTKPGYTIPFEDMKERMLFAEAIDTVRCFDEGVLRSAADANV
GSILGIGFPPWTGGVVQYINGYEGPSGTGPRGFVIRARQLAERYGKHFLPPASLVAKAER
GELLE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacagaacaccctgcgctgggaacaggacgcggacggcatcgtcgtcttgacg
atggacgacccctcccagtccgccaacaccatgaacgccgcctacgtgaagtccatgcgc
gcggcggtggaccggctggtgaaggagaaggacagcatcaccggcgtcgtcatcacctcc
gcgaagaagaccttcttcgcgggcggcgacttgaacgacctgcgcaacgtgaagaaggac
gcggcgagccaggtcttcaacctgggccaggagatcaaggcgcagctgcgcacgctggag
accctgggcaagcccgtggtcgcggccatcaacggcgcggcgctgggcggcggtcttgaa
atcgcgctcgcctgtcaccaccgcatcctcgcggacgtgaagggcgcggtggtgggcctg
ccggaggtgacgctgggcctgctgcccggcggcggcggcgtggtgcgcacggtgcgcatg
ctgggcatcacggacgcgctgatgaaggtgctgctccagggccagaaataccgcccgcag
gaggcgaaggagctggggctggtgcaggaggtggtgccgtccgtggacgcgctcctgccc
gcggcgaaggcgtgggtgaaggcgaacccgaaggcgcagcagccgtgggaccagaagggc
tacaagatccccggcggcacgccgtcccacccggcgttcgcggcgaacctgcccgcgttc
cccgccaacctgcgcaagcagctcaagggcacgaacatgcccgccccgcgcgccatcatg
gcggtggcggtggagagcacgcaggtggacgtggacaccgcgttcaccatcgagtcgcgc
tacttcacggagctcgtcgtcggccaggtcgcgaagaacatgatccaggcgttcttcttc
gacatgcagcacatcaactccggcggcggccgcccccagggctatccgaagcacaccgcg
aagaaggtgggcgtgctgggcgcgggcatgatgggcgcgggcatcgcctacgtgtgcgcc
aaggccggcatcgacgtggtgctcaaggacgtgagcctcgccgccgcggagaagggcaag
ggctactccgtcaagctggtggagaaggccgtcgccaagggctccgtcacgaaggagaag
ggcgacgcgctgctggcgcgcatcacccccgcggaggacccggccgcgctcgcgggctgc
gacctggtcatcgaagccgtgttcgaggacgtgaagctcaagcacaaggtcttccaggag
attcaaggcgtggtggcgccggacgcggtgctggggtccaacacctccaccctgcccatc
accctgctcgcggagggcgtgaaccggccgccggacttcgtcggcatgcacttcttctcc
cccgtggacaagatgccgctcttggagctcatcgccggcaagcagaccagcgacgcgacg
ctggcgaaggccatcgacatcgcggtgcagattggcaagacgcccatcgtcgtcaacgac
agccggggcttcttcaccagccgcgtcatcggcacgttcctcaacgaggccatcgccatg
gtgggcgagggcatcgcgcccgcgtccatcgagcaggcgggactccaggcgggctacccc
gccgccccgctccagctggtggacgaattgacgctcacgctgccccggaagatccgccag
gagacgaaggcggccgtggaggccgcgggccagccgtgggcggaccacggcagctacgcg
gtgatggacgcgatgatcgaccagcacgggcgcaagggccgctccacgggcggagggttc
tacgactacgcggacggcaagcggacgaacctgtggccggggctgaagcagcactacacg
aagcccggctacaccatccccttcgaggacatgaaggagcggatgctcttcgcggaggcc
atcgacacggtgcgctgcttcgacgagggcgtgctgcgctcggcggcggacgcgaacgta
ggctccatcctgggcatcggcttcccgccgtggacgggcggcgtcgtgcagtacatcaac
ggctacgaaggcccgtccggcacggggccgcgcggcttcgtcatccgcgcgcgccagctg
gcggagcgctacgggaagcacttcctgccgcccgcgtccctggtcgccaaggctgaacgt
ggagagctgctcgagtaa

DBGET integrated database retrieval system