KEGG   Corallococcus coralloides: COCOR_02168Help
Entry
COCOR_02168       CDS       T01780                                 

Gene name
fadJ1
Definition
(GenBank) fatty oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00071  Fatty acid degradation
ccx00280  Valine, leucine and isoleucine degradation
ccx00281  Geraniol degradation
ccx00310  Lysine degradation
ccx00362  Benzoate degradation
ccx00380  Tryptophan metabolism
ccx00410  beta-Alanine metabolism
ccx00640  Propanoate metabolism
ccx00650  Butanoate metabolism
ccx00903  Limonene and pinene degradation
ccx00930  Caprolactam degradation
ccx01040  Biosynthesis of unsaturated fatty acids
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01200  Carbon metabolism
ccx01212  Fatty acid metabolism
Module
ccx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    COCOR_02168 (fadJ1)
   00650 Butanoate metabolism
    COCOR_02168 (fadJ1)
  Lipid metabolism
   00071 Fatty acid degradation
    COCOR_02168 (fadJ1)
   01040 Biosynthesis of unsaturated fatty acids
    COCOR_02168 (fadJ1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_02168 (fadJ1)
   00310 Lysine degradation
    COCOR_02168 (fadJ1)
   00380 Tryptophan metabolism
    COCOR_02168 (fadJ1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCOR_02168 (fadJ1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    COCOR_02168 (fadJ1)
   00281 Geraniol degradation
    COCOR_02168 (fadJ1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COCOR_02168 (fadJ1)
   00930 Caprolactam degradation
    COCOR_02168 (fadJ1)
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     COCOR_02168 (fadJ1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     COCOR_02168 (fadJ1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     COCOR_02168 (fadJ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 2-Hacid_dh_C F420_oxidored UDPG_MGDP_dh_N NAD_Gly3P_dh_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFE08745
UniProt: H8MKB9
Position
complement(2606636..2608813)
Genome map
AA seq 725 aa AA seqDB search
MSEQNTLRWEQDADGIVVLTMDDPSQSANTMNAAYVKSMRAAVDRLVKEKDSITGVVITS
AKKTFFAGGDLNDLRNVKKDAASQVFNLGQEIKAQLRTLETLGKPVVAAINGAALGGGLE
IALACHHRILADVKGAVVGLPEVTLGLLPGGGGVVRTVRMLGITDALMKVLLQGQKYRPQ
EAKELGLVQEVVPSVDALLPAAKAWVKANPKAQQPWDQKGYKIPGGTPSHPAFAANLPAF
PANLRKQLKGTNMPAPRAIMAVAVESTQVDVDTAFTIESRYFTELVVGQVAKNMIQAFFF
DMQHINSGGGRPQGYPKHTAKKVGVLGAGMMGAGIAYVCAKAGIDVVLKDVSLAAAEKGK
GYSVKLVEKAVAKGSVTKEKGDALLARITPAEDPAALAGCDLVIEAVFEDVKLKHKVFQE
IQGVVAPDAVLGSNTSTLPITLLAEGVNRPPDFVGMHFFSPVDKMPLLELIAGKQTSDAT
LAKAIDIAVQIGKTPIVVNDSRGFFTSRVIGTFLNEAIAMVGEGIAPASIEQAGLQAGYP
AAPLQLVDELTLTLPRKIRQETKAAVEAAGQPWADHGSYAVMDAMIDQHGRKGRSTGGGF
YDYADGKRTNLWPGLKQHYTKPGYTIPFEDMKERMLFAEAIDTVRCFDEGVLRSAADANV
GSILGIGFPPWTGGVVQYINGYEGPSGTGPRGFVIRARQLAERYGKHFLPPASLVAKAER
GELLE
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacagaacaccctgcgctgggaacaggacgcggacggcatcgtcgtcttgacg
atggacgacccctcccagtccgccaacaccatgaacgccgcctacgtgaagtccatgcgc
gcggcggtggaccggctggtgaaggagaaggacagcatcaccggcgtcgtcatcacctcc
gcgaagaagaccttcttcgcgggcggcgacttgaacgacctgcgcaacgtgaagaaggac
gcggcgagccaggtcttcaacctgggccaggagatcaaggcgcagctgcgcacgctggag
accctgggcaagcccgtggtcgcggccatcaacggcgcggcgctgggcggcggtcttgaa
atcgcgctcgcctgtcaccaccgcatcctcgcggacgtgaagggcgcggtggtgggcctg
ccggaggtgacgctgggcctgctgcccggcggcggcggcgtggtgcgcacggtgcgcatg
ctgggcatcacggacgcgctgatgaaggtgctgctccagggccagaaataccgcccgcag
gaggcgaaggagctggggctggtgcaggaggtggtgccgtccgtggacgcgctcctgccc
gcggcgaaggcgtgggtgaaggcgaacccgaaggcgcagcagccgtgggaccagaagggc
tacaagatccccggcggcacgccgtcccacccggcgttcgcggcgaacctgcccgcgttc
cccgccaacctgcgcaagcagctcaagggcacgaacatgcccgccccgcgcgccatcatg
gcggtggcggtggagagcacgcaggtggacgtggacaccgcgttcaccatcgagtcgcgc
tacttcacggagctcgtcgtcggccaggtcgcgaagaacatgatccaggcgttcttcttc
gacatgcagcacatcaactccggcggcggccgcccccagggctatccgaagcacaccgcg
aagaaggtgggcgtgctgggcgcgggcatgatgggcgcgggcatcgcctacgtgtgcgcc
aaggccggcatcgacgtggtgctcaaggacgtgagcctcgccgccgcggagaagggcaag
ggctactccgtcaagctggtggagaaggccgtcgccaagggctccgtcacgaaggagaag
ggcgacgcgctgctggcgcgcatcacccccgcggaggacccggccgcgctcgcgggctgc
gacctggtcatcgaagccgtgttcgaggacgtgaagctcaagcacaaggtcttccaggag
attcaaggcgtggtggcgccggacgcggtgctggggtccaacacctccaccctgcccatc
accctgctcgcggagggcgtgaaccggccgccggacttcgtcggcatgcacttcttctcc
cccgtggacaagatgccgctcttggagctcatcgccggcaagcagaccagcgacgcgacg
ctggcgaaggccatcgacatcgcggtgcagattggcaagacgcccatcgtcgtcaacgac
agccggggcttcttcaccagccgcgtcatcggcacgttcctcaacgaggccatcgccatg
gtgggcgagggcatcgcgcccgcgtccatcgagcaggcgggactccaggcgggctacccc
gccgccccgctccagctggtggacgaattgacgctcacgctgccccggaagatccgccag
gagacgaaggcggccgtggaggccgcgggccagccgtgggcggaccacggcagctacgcg
gtgatggacgcgatgatcgaccagcacgggcgcaagggccgctccacgggcggagggttc
tacgactacgcggacggcaagcggacgaacctgtggccggggctgaagcagcactacacg
aagcccggctacaccatccccttcgaggacatgaaggagcggatgctcttcgcggaggcc
atcgacacggtgcgctgcttcgacgagggcgtgctgcgctcggcggcggacgcgaacgta
ggctccatcctgggcatcggcttcccgccgtggacgggcggcgtcgtgcagtacatcaac
ggctacgaaggcccgtccggcacggggccgcgcggcttcgtcatccgcgcgcgccagctg
gcggagcgctacgggaagcacttcctgccgcccgcgtccctggtcgccaaggctgaacgt
ggagagctgctcgagtaa

DBGET integrated database retrieval system