KEGG   Corallococcus coralloides: COCOR_02169Help
Entry
COCOR_02169       CDS       T01780                                 

Gene name
fadA1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccx  Corallococcus coralloides
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    COCOR_02169 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    COCOR_02169 (fadA1)
   00640 Propanoate metabolism
    COCOR_02169 (fadA1)
   00650 Butanoate metabolism
    COCOR_02169 (fadA1)
  Lipid metabolism
   00071 Fatty acid degradation
    COCOR_02169 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    COCOR_02169 (fadA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_02169 (fadA1)
   00310 Lysine degradation
    COCOR_02169 (fadA1)
   00380 Tryptophan metabolism
    COCOR_02169 (fadA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COCOR_02169 (fadA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COCOR_02169 (fadA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    COCOR_02169 (fadA1)
Enzymes [BR:ccx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     COCOR_02169 (fadA1)
Exosome [BR:ccx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCOR_02169 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2608852..2610063)
Genome map
AA seq 403 aa AA seqDB search
MSQEAFIFDAVRTPRGKGKKGALHGTKPVSLLVGLVDALKQRHPNLDPKHIDDVVLGVVS
PVGDQGADIARTLVLAAGLPETTGGVQLNRFCASGLTAVNMAAQQVRSGWEHLVIAGGVE
SMSRVPMGSDGGAWAMDPATNYDTYFVPQGISADLIATMEGFTREDVDRYAVRSQERAAH
AWKNGYFQKSVVPVVDQNGLTILDRDEHMRPDSTVASLGQLSASFTTMGEMGGFDAVALQ
KYHAVERINHVHTPGNSSGIVDGAALVLVGSEKVGKTLGLKPRARIAAVATSGAEPTIML
TGPLPATRKLLDIAGLSVKDIDLFELNEAFASVVLKYQKDLDIPDEKLNVNGGAIAMGHP
LGATGAMILGTVVDELERRNARRAVVTLCVGGGMGVATLVERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggaagcattcatcttcgacgccgtccgtacccctcgcggcaagggcaagaag
ggcgccctgcacggcaccaagccggtgtcgctgctcgtcggcctggtggacgcgctcaag
cagcgccacccgaacctggacccgaagcacatcgacgacgtggtgctgggcgtcgtgtcc
cccgtgggtgaccagggcgcggacatcgcgcgcacgctggtgctggccgcgggcctgccg
gagaccaccggcggcgtgcagctcaaccgcttctgtgcctccggcctgacggcggtgaac
atggccgcgcagcaggtgcgctccggctgggagcacctggtcatcgcgggcggcgtggag
agcatgtcccgcgtccccatgggctccgacggcggcgcgtgggccatggaccccgccacc
aactacgacacctacttcgtgccccagggcatctccgcggacctcatcgcgacgatggag
ggcttcacccgcgaggacgtggaccgctacgccgtgcgctcgcaggagcgcgcggcccac
gcgtggaagaacggctacttccagaagtccgtcgtccccgtggtggaccagaacgggctc
accatcctggaccgcgatgagcacatgcgtccggactccaccgtggcctcgctgggccag
ctgagcgcgtccttcacgaccatgggtgagatgggcggcttcgacgcggtggcgctccag
aagtaccacgcggtggagcgcatcaaccacgtgcacacgccgggcaactcctccggcatc
gtggacggcgcggcgctggtgctggtgggctcggagaaggtgggcaagacgctgggcctc
aagccgcgcgcgcgcatcgccgccgtggccacgtccggcgcggagcccaccatcatgctc
accggtccgctgccggccacccgcaagctgctggacatcgccggcctgtcggtgaaggac
atcgacctcttcgagctcaacgaggccttcgcctccgtggtcctcaagtaccagaaggac
ctggacatcccggacgagaagctcaacgtcaacggcggcgccatcgccatggggcacccg
ctgggtgccaccggcgccatgatccttggaaccgtggtggatgaactggagcggcgcaac
gcgcgccgcgcggtcgtcaccctgtgcgtcggcggcggaatgggtgtggccaccctcgtc
gagcgcgtctga

DBGET integrated database retrieval system