KEGG   Corallococcus coralloides: COCOR_02198Help
Entry
COCOR_02198       CDS       T01780                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00071  Fatty acid degradation
ccx00280  Valine, leucine and isoleucine degradation
ccx00281  Geraniol degradation
ccx00310  Lysine degradation
ccx00362  Benzoate degradation
ccx00380  Tryptophan metabolism
ccx00410  beta-Alanine metabolism
ccx00640  Propanoate metabolism
ccx00650  Butanoate metabolism
ccx00903  Limonene and pinene degradation
ccx00930  Caprolactam degradation
ccx01040  Biosynthesis of unsaturated fatty acids
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01200  Carbon metabolism
ccx01212  Fatty acid metabolism
Module
ccx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    COCOR_02198 (fadJ)
   00650 Butanoate metabolism
    COCOR_02198 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    COCOR_02198 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    COCOR_02198 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_02198 (fadJ)
   00310 Lysine degradation
    COCOR_02198 (fadJ)
   00380 Tryptophan metabolism
    COCOR_02198 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCOR_02198 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    COCOR_02198 (fadJ)
   00281 Geraniol degradation
    COCOR_02198 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COCOR_02198 (fadJ)
   00930 Caprolactam degradation
    COCOR_02198 (fadJ)
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     COCOR_02198 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     COCOR_02198 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     COCOR_02198 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFE08744
UniProt: H8MKE9
Position
2646902..2649139
Genome map
AA seq 745 aa AA seqDB search
MATKQEAVEAKQGLSYDVTNGVAVITVDQPGAPVNTLSPEVGTAFSDLLVQAERDPEVKA
VVFISGKKDNFVAGANIDFLQTLKTPADVEAISRGAHEQFDRLESFSKPVVAAIHGACLG
GGLEWVLACHYRIVTDSPKSVVGLPETQLGLIPGAGGTQRLPALIGAEAALDLILTGKNV
KPSKAKKLGIVDEVVPVPMLKDIALKRAVELAAGTLKVERSHQGFKAVAQSGKKKGIAGI
FQGLINKDLWKEAALEDNPLGRKVMFDQAKKQLLKKTRGKYPAQEKALQVIRVGLESGRK
AGLDAEAKAFGELVFTDVSRRLVEIFFATTALKKENGTANPNLKPREVKKVGVLGGGLMG
GGIAYVAGVLQGVPVRVKDRDDAGAGRALKQVQTVLDERVKRRSLTRLESNAKLSNITAG
TDYSGFKSVDLVIEAVFEDLKLKHQVIAEVEAVTGENTIFASNTSSLPIGELAKGSKRPS
QVIGMHYFSPVHKMPLLEIITHPGTAEWVTATCVDVGKKQGKTVIVVNDGPGFYTSRILA
PYMNEAAYLLAEGADIVQLDKALVDFGFPVGPITLLDEVGIDVAQKVGPIMEAAFGKRMA
APKALEGVVSDGRLGRKTNKGFYLYENGKKKEVDPQVYLLLPHGKDRKSLEASEMAERVA
LQMVNEAIRCLGEGILRNARDGDVGAIFGLGFPPFLGGPFRYADALGPANLLRKLEHYQD
KYGERFTPAPLLVEKVRAGKGFYES
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaagcaagaggcagtcgaagcgaagcagggcttgagctacgacgtcacgaac
ggcgtcgcggtcatcaccgtggaccagccgggcgcgccggtgaacacgctgtctccggaa
gtgggcaccgcgttctcggatctgctcgtgcaggcggagcgggacccggaggtgaaggcc
gtcgtcttcatctccggcaagaaggacaacttcgtcgccggcgcgaacatcgacttcctg
cagaccctgaagacgcccgcggacgtggaggccatcagccgcggcgcgcacgagcagttc
gaccggctggagtccttctccaagccggtggtcgcggccatccacggcgcgtgcctgggc
ggcggcctggagtgggtgctcgcgtgccactaccgcatcgtcacggacagccccaagtcg
gtggtgggcctgccggagacgcagctgggcctcatccccggcgctggcggcacgcagcgg
ctgcccgcgctgattggcgcggaggccgcgctggacctcatcctcaccggcaagaacgtc
aagccgtccaaggcgaagaagctgggcatcgtggatgaagtcgtgccggtgcccatgctc
aaggacatcgccctcaagcgcgcggtggagctggcggcgggcacgctcaaggtggagcgc
tcgcaccagggcttcaaggccgtggcccagagcggcaagaagaagggcatcgccggcatc
ttccaggggctcatcaacaaggacctgtggaaggaagcggcgctggaggacaacccgctc
ggccgcaaggtgatgttcgaccaggcgaagaagcagctcctgaagaagacgcgcggcaag
taccccgcgcaggagaaggcgctgcaggtcatccgtgtgggcctggagtccggccgcaag
gcgggcctggacgcggaggcgaaggcctttggcgagctggtgttcacggacgtgtcgcgg
cgcctggtcgaaatcttcttcgccaccacggcgctgaagaaggagaacggcaccgccaac
cccaacctgaagccgcgcgaggtgaagaaggtgggcgtgctgggcggcggcctcatgggc
ggcggcatcgcctacgtggccggcgtgctccagggcgtgcccgtgcgcgtgaaggaccgg
gacgacgcgggcgcgggccgcgcgctcaagcaggtgcagacggtgctggatgagcgcgtg
aagcgccgctcgctcacccggctggagtccaacgcgaagctgtccaacatcaccgcgggc
acggactacagcggcttcaagtcggtggacctggtgattgaagcggtgttcgaggacctg
aagctcaagcaccaggtcatcgcggaggtggaggccgtcaccggcgagaacaccatcttc
gcgtccaacacctccagcctgcccattggcgagctggcgaagggcagcaagcgcccctcg
caggtgattggcatgcactacttcagcccggtccacaaaatgccgctgctggagatcatc
acgcacccgggcaccgcggagtgggtgacggccacctgcgtggacgtgggcaagaagcag
ggcaagacggtcatcgtcgtcaacgacgggccgggcttctacacgtcgcgcatcctcgcg
ccgtacatgaacgaggccgcgtacctgctggcggaaggcgcggacatcgtccagctggac
aaggcgctggtggacttcggcttcccggtggggcccatcacgctgttggacgaggtgggc
atcgacgtggcccagaaggtggggcccatcatggaggccgcgttcggcaagcgcatggcg
gcgcccaaggcgctggagggcgtggtgtccgacggccgcctgggccgcaagacgaacaag
ggcttctacctgtacgagaacgggaagaagaaggaggtggacccgcaggtctacctgctc
ctgccgcacggcaaggaccgcaagtccctggaggcctcggagatggccgagcgcgtcgcg
ctgcagatggtgaacgaggccatccgctgcctgggggaggggatcctgcgcaacgcgcgc
gacggcgacgtgggcgccatcttcggcctgggcttcccgccgttcctgggcggcccgttc
cggtacgcggacgccctgggcccggccaacctgctgcgcaagctggagcactaccaggac
aagtacggcgagcgcttcacgcccgcgccgctgctggtggagaaggtgcgcgccggcaag
ggcttctacgagtcctga

DBGET integrated database retrieval system