KEGG   Corallococcus coralloides: COCOR_02328Help
Entry
COCOR_02328       CDS       T01780                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ccx  Corallococcus coralloides
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COCOR_02328 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COCOR_02328 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    COCOR_02328 (thrC1)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     COCOR_02328 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2802378..2803550
Genome map
AA seq 390 aa AA seqDB search
MSVLRLECTKCDQTFAPGKVWNLCTACQAPLFARYDLERAAKTLRKEALPGRERSMWRYH
EVLPVDDPAQRLTLGEGFTPLLPAPRLGSWLGLQRVWVKDESGNPTGSFKARGLSAAVSM
AKVLGAKAVCLPSAGNAGSALAAYAARGALEAHVFVPKDIASLFLMETRAYGAHVETVDG
LISDAGRVCAGLAKEHGWYECATLKEPYRVEGKKTMGYELAEQLGWTLPDVILYPTGGGT
GLIGMWKAFEEMEAMGLIDSKRPRMVAVQAEGCAPIVKAHAEGKPDAPMWQGATTHAHGL
RVPKALGDFLILRAVKDSHGTAVSVTEAEIVQGTKDAAAAEGLFMAPEGGACVAALKKLQ
ATGDVKPEETVVVFNTGTGFKYVENMAPLW
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcctccgacttgaatgcacgaagtgcgaccagacgtttgcgccgggcaaggtg
tggaacctgtgcacggcgtgtcaggcgccgctgttcgcccgctacgacctggagcgcgcg
gcgaagacgctgcgcaaggaagcgctgcccggacgtgagcgctccatgtggcgctaccac
gaggtgctgccggtggatgacccggctcagcgcctgacgttgggcgaaggcttcacgccg
ctgctccccgcgccccggctgggctcatggctgggattgcagcgggtgtgggtgaaggac
gagagcggcaacccgacgggctccttcaaggcgcgaggcctgtccgccgcggtgtccatg
gcgaaggtactgggcgcgaaggcggtgtgtctgccatccgcgggaaacgcgggcagcgcg
ctggcggcgtacgcggcgcggggcgcgctggaggcgcacgtcttcgtgccgaaggacatc
gcgtcgctgttcctgatggagacgcgggcctacggcgcgcatgtcgagacggtggatggg
ctcatctccgacgcgggccgggtgtgcgcggggctggcgaaggagcatggctggtacgag
tgcgccacgctgaaggagccctaccgggtcgagggcaagaagacgatgggctacgagctg
gcggagcagctcgggtggacgctgccggacgtcatcctctatccaacgggcgggggcacg
gggctcatcgggatgtggaaggccttcgaggagatggaggcgatggggctgattgattcg
aagcggccccggatggtggcggtgcaggcggaagggtgcgcgcccatcgtgaaggcgcac
gcggaaggcaagccggacgcgcccatgtggcagggcgcgacgacgcacgcgcacggcctg
cgggtgcccaaggcgctgggggacttcctcatcctgcgcgcggtgaaggacagccacggc
acggcggtgtcggtgacggaggcggagatcgtccagggcacgaaggacgcagccgcggcg
gaaggactgttcatggcgccggaaggaggcgcatgcgtggcggcgctcaagaagcttcag
gccaccggggacgtgaagcccgaggagacggtcgtcgtattcaacacgggcacgggcttc
aagtacgtggagaacatggcgccgctgtggtga

DBGET integrated database retrieval system