KEGG   Corallococcus coralloides: COCOR_02334Help
Entry
COCOR_02334       CDS       T01780                                 

Gene name
choD1
Definition
GMC oxidoreductase family protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ccx  Corallococcus coralloides
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2808322..2809965
Genome map
AA seq 547 aa AA seqDB search
MDCDWLIIGSGFGGSVSALRLVEKGYRVVMLEKGRRLRGQDFPKSNWNLKRWLWMPRLGW
RGLFKMTFFRHVTVLSGVGVGGGSLVYANTLPIPRDDFFDATSWGHLAPWKEELAPHYAT
ARRMLGATVNPLNTFPDQVLKEVGEDLGRPDFQPTTVAIYFGEPGVTVKDPYFSGEGPDR
TGCNACGGCMLGCRNNAKNTLDKNYLYFAEKKGLTLHADTEVTWVRPLPGGDGYEVTAKQ
GTGFFKKTRRFTAKHVIFAGGVLGTMDLLLKLKGAPDGLPKLSERVGDGVRTNSEALIGV
ISGKKQKDRDLSRGIAIGSILHTDEHSHLEPVRYPAGSGFFRLLMAPHVPGATAWSRVAR
LVGLLARRPLRFLQAFFVPDFARRTMILLYMRTMEGHLRMRRGRALTTGFRSGLTTGLQA
GPAPTANMPEAFDLAKRVSDKLDGYPMTMVSETLMGIPTTAHILGGACMGDSPTTGAIDA
RHRLYGYEGLYVVDGAAISANPGVNPSLTIAALAERAMTFIPAARELPRGDTDATLEAPS
RAHAAAS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggactgcgactggctcatcatcggctcggggtttggcggcagcgtcagcgcgttgcgg
ctcgtcgagaagggctatcgcgtggtgatgctggagaagggccggcgcctccggggccag
gacttccccaagtccaactggaacctgaagcgctggctgtggatgccgcggctcgggtgg
cgcggcctcttcaagatgaccttcttccgccacgtcaccgtgctgtccggcgtcggcgtg
ggcggcggctcgctcgtctacgccaacacgctgcccatcccacgggacgacttcttcgac
gccacctcctggggccacctggcgccgtggaaggaggagctcgcgccgcactacgcgacc
gcgcgccgcatgctgggcgccaccgtcaacccgctcaacaccttccctgatcaggtgctc
aaggaagtgggagaggacctgggccgccccgacttccagcccaccaccgtggccatctac
ttcggcgagcccggcgtcaccgtgaaggacccctacttcagcggcgagggcccggaccgc
accggctgcaacgcgtgcggcggctgcatgctgggctgccgcaacaacgccaagaacacg
ctcgacaagaactacctctacttcgcggagaagaagggcctcaccctccacgcggacacg
gaggtgacgtgggtgcgccccctgcccggtggcgacggttacgaggtgacggcgaagcag
ggcaccggcttcttcaagaagacgcgccgcttcaccgcgaagcacgtcatcttcgcgggc
ggcgtgctgggcaccatggacctgctgctcaagctcaagggcgcgccagacggcctgccc
aagctctccgagcgcgtgggcgatggcgtgcgcaccaactccgaggcgctcatcggcgtc
atcagcggcaagaagcagaaggaccgcgacctgtcccggggcatcgccatcgggtccatc
ctccacaccgacgagcactcgcacctggagcccgtgcgctacccggcgggctccggcttc
ttccgcctgctcatggccccgcacgtccccggcgccaccgcgtggtcgcgcgtggcccgg
ctggtggggctgctcgcgcgccgtcccctgcgcttcctccaggccttcttcgttccggac
ttcgcgcgccgcacgatgatcctcctgtacatgcgcaccatggagggccacctgcgcatg
cgccggggccgcgcgctcaccaccggcttccgctccggcctcaccaccggcctgcaggcg
ggccccgcgcccaccgcgaacatgccggaggccttcgacctggcgaagcgcgtgtccgac
aagctggatggctaccccatgaccatggtcagcgaaacgctcatgggcatcccgaccacc
gcgcacatcctgggcggcgcgtgcatgggggactcgcccacgacaggcgccatcgacgcg
cgccaccgcttgtatggctatgagggcctgtacgtggtggatggcgcggccatctccgcc
aacccgggcgtcaatccctcgctcaccatcgccgcgctcgccgagcgtgccatgaccttc
atccccgccgcccgggagctgccccgcggcgacacggacgccacgctcgaagcgccctcg
cgcgcccacgccgccgcctcctga

DBGET integrated database retrieval system