KEGG   Corallococcus coralloides: COCOR_02475Help
Entry
COCOR_02475       CDS       T01780                                 

Gene name
fpgX
Definition
formamidopyrimidine DNA-glyxosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ccx  Corallococcus coralloides
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    COCOR_02475 (fpgX)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     COCOR_02475 (fpgX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     COCOR_02475 (fpgX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2990430..2991287
Genome map
AA seq 285 aa AA seqDB search
MAEVPEVEIIVRDLKQAVVGRRFVGAEVLMPAAVRFAAPPDFIQNLQGRKVLAAERRAKF
MLLTLDDGQTLALHFMLWGELQLRPAGSERPPETLVVLTLEGNEELQLTDTLGYARVALG
PTALLASQLKLEELGPEALDETFTPEVLAKQLRRRRSPLKTVLLNQRVLAGLGNRDADES
LWVAGIDPRRLASSLSPAEIVRLHQGIRDVLEEGLRLRGTQRDLFGVQGQAKHRRNIFGK
TGAPCPRCATPVSHLRIGGRNTHWCAHCQPADGASTEAPAQTSLL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaagtccctgaagtcgaaatcatcgtccgagacctgaagcaggccgtcgtgggc
cggcgcttcgtgggcgcggaggtgctgatgcccgcggcggtgcgcttcgccgcgccgccg
gacttcatccagaacctccagggccgcaaggtgctcgcggcggagcggcgcgcgaagttc
atgctgctcacgctggatgacgggcagacgctcgcgctgcatttcatgctctggggggag
ttgcagctgcggcccgctggaagcgaacggcctcccgagacgctcgtggtcctcacgctg
gaggggaacgaagagctccagctcacggacacgctgggctacgcgcgcgtggcgctgggg
cccacggcgctgctggcctcgcagctcaagctggaggagctgggaccggaggcgctcgat
gagacgttcactccggaggtcctggcgaagcagcttcgccgcaggcgcagtccgctcaag
acggtgctcctgaaccagcgcgtgctcgcggggctgggcaaccgcgacgcggacgagagc
ctgtgggtcgcgggcatcgacccccggcggctggcgtcgtccctgtctcccgctgaaatc
gtccggctgcaccagggcatccgcgacgtgctggaagaagggctgcggctgcgcggcacg
cagcgcgacctgttcggcgtgcaggggcaggcgaagcaccggcgcaacatcttcggcaag
acgggggcgccgtgtccccgctgcgccacgcccgtgtctcacctgcgcatcggcggccgc
aacacgcactggtgtgcgcactgccagcccgcggacggcgcctcgacggaggccccggcg
cagacgtcactgctctga

DBGET integrated database retrieval system