KEGG   Corallococcus coralloides: COCOR_02481Help
Entry
COCOR_02481       CDS       T01780                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ccx  Corallococcus coralloides
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    COCOR_02481 (ruvA)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     COCOR_02481 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2994906..2995520
Genome map
AA seq 204 aa AA seqDB search
MIARLRGNVLEKGPEDAVVDVNGVGYRVNLSTVSLGKLPADGQPVDLRIRTVVREDAFEL
FGFLSPAEEELFQLLNTVSRVGPRMALGVMSGMEVGELIAALSRGETSRLAKIHGVGKKT
AERLVLELKEKVRNLHSEGIAKGTTPRAPVTSGSKADLVSALLNLGYKQPQAEKAADVVI
AQLGPDASFQALFREALKALRSSP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccggctgcgtggcaacgtgttggagaagggccctgaagacgccgtcgtggac
gtgaacggcgtgggctaccgcgtgaacctgtccaccgtctcgctgggcaagctgcccgcg
gacggccagccggtggacctgcgcatccgcaccgtggtgcgcgaggacgccttcgagctc
ttcggcttcctctccccggcggaggaggagctcttccagctgctcaacaccgtgtcccgc
gtcggtccgcgcatggccctgggcgtgatgtccggcatggaggtgggcgagctcatcgcg
gcgctgtctcgcggtgagacgagccggctcgcgaagatccacggcgtgggcaagaagacc
gcggagcggctcgtgctggagctcaaggagaaggtgcgcaacctccactcggagggcatc
gcgaagggcaccaccccgcgcgcgcccgtcacctccggcagcaaggcggacctcgtctcc
gcgctgctcaacctgggctacaagcagccccaggcggagaaggccgcggacgtcgtcatc
gcgcagctgggcccggacgcctccttccaggcgctcttccgcgaagccctcaaggccctg
cgctccagcccgtga

DBGET integrated database retrieval system