KEGG   Corallococcus coralloides: COCOR_02690Help
Entry
COCOR_02690       CDS       T01780                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00230  Purine metabolism
ccx01100  Metabolic pathways
Module
ccx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    COCOR_02690 (gmk)
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     COCOR_02690 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 AAA_22 AAA_17 DnaB_C AAA IPPT NTPase_1 RNA_helicase TsaE AAA_25 MobB cobW ABC_tran AAA_35
Motif
Other DBs
NCBI-ProteinID: AFE08957
UniProt: H8MTZ9
Position
3333904..3334527
Genome map
AA seq 207 aa AA seqDB search
MNEPTGLQPGLLLVLSAPSGAGKTTLAHRLLKEMPDGIFSTSVTTRRPRGKEQEGVDYHF
VGVAAFQEKIEKGEFVEWAEVHGHFYGSPQSVVDEARTRRGTAIFDIDVQGGQAIKRKHP
DAVLIFVLPPSMEELERRLRDRQTDSDETIRRRMLAARSEIERGIASYDYVVVNDDFERA
YQELRSVVVAEKCRRGRVDLSKLKLGS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacccactggactccagcctggcctgctcctcgtcctctccgcgccgtccgga
gctggaaagaccaccctcgcgcaccggctgctgaaggagatgccggacggcatcttctcc
accagcgtcaccacccggcgcccccggggcaaggagcaggagggcgtggactaccacttc
gtgggagtcgccgccttccaggagaagatcgagaagggcgagttcgtggagtgggccgag
gtacacggccacttctatggcagcccccagtcggtggtggatgaagcccgcacgcgccgt
ggcaccgccatcttcgacatcgacgtccagggcgggcaggccatcaagcgcaagcacccc
gacgcggtcctcatcttcgtgctgcccccctccatggaggagctggagcggcggcttcgg
gatcgtcagacggactcggacgaaaccatccgccgccggatgctggccgcccgctcggag
atcgagcggggaatcgcgtcctacgactacgtcgtggtgaacgacgacttcgagcgcgcc
tatcaggagctgcgctcggtggtggtcgcggagaagtgccggcgggggagggtggacctc
tccaagctcaagctcggaagctga

DBGET integrated database retrieval system