KEGG   Corallococcus coralloides: COCOR_02903Help
Entry
COCOR_02903       CDS       T01780                                 

Gene name
galM2
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ccx  Corallococcus coralloides
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_02903 (galM2)
   00052 Galactose metabolism
    COCOR_02903 (galM2)
Enzymes [BR:ccx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     COCOR_02903 (galM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3598300..3599364
Genome map
AA seq 354 aa AA seqDB search
MERSSFGTAPGGQPVDVYTLTNRQGMEARVTNYGGIILSLRVPDRDGRFDDVVLGYDALA
DYVAESPYFGALVGRYGNRIARGRFTLDGRQYTLATNNGVNHLHGGLKGFDKVVWAAAPF
ENDQGMGLVLTYVSPDGEEGYPGTLTVRVTYTLTADNALVFDYHATTDRPTPVNLTQHSY
FNLAGDGRRDILDHVVTFHADRFVPIDATSIPLGPLRDVTGTPFDFRRPTAIGARIQQDD
EQLRNGLGYDHSLVLDKGGQPGALTLAAHVLEPTTGRVMEVHTTEPGMQFYSGNFLNGTL
KGKRGAVYHHRFGFALETQHLPDSPNQPDFPSTLLRPGDQYRSRTVYRFSVAGA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggagcggagttccttcggtacggccccgggcggacagcccgtggatgtctataccctc
accaaccggcaggggatggaggcgcgcgtcaccaactacggcggcatcatcctcagcctg
cgcgtgccggaccgggacggccgcttcgacgacgtggtgctgggctacgacgcgctggcg
gactacgtggcggagtccccgtacttcggcgcgctcgtcggccgctatggcaaccgcatc
gcccggggccgcttcacgctcgacggccggcagtacacgctggcgacgaacaacggggtg
aaccacctgcacggcgggctcaagggcttcgacaaggtggtgtgggcggcggcgcccttc
gagaacgaccagggcatgggcctggtcctcacctacgtcagtcccgacggcgaggagggc
tatccggggacgctgacggtgcgggtgacgtacacgctgaccgccgacaacgcgctcgtc
ttcgactaccacgccaccacggacaggcccacgccggtcaacctcacgcagcacagctac
ttcaacctcgcgggcgacgggcggcgcgacatcctggaccatgtcgtcacgttccacgcg
gaccgcttcgtcccgattgacgcgacgtccatcccgctggggccgctgcgcgacgtgacg
ggcacgccgttcgacttccggcggcccacggccatcggcgcgcgcatccagcaggacgac
gagcagctgcgcaacgggcttggctatgaccacagcctcgtgctcgacaagggcggccag
cccggcgcgctgacgctggccgcgcacgtcctggagcccaccaccggccgggtgatggag
gtccacaccacggagccgggcatgcagttctattccggcaacttcctcaacggcacgctg
aaggggaagcggggcgccgtctaccaccaccgcttcggcttcgcgctggagacccagcac
ctgccagactcgccgaaccagccggacttcccctccaccctcctgcgccccggcgaccag
taccgctcgcgcaccgtctaccgcttctccgttgctggcgcgtga

DBGET integrated database retrieval system