KEGG   Corallococcus coralloides: COCOR_02912Help
Entry
COCOR_02912       CDS       T01780                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccx  Corallococcus coralloides
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    COCOR_02912
   00052 Galactose metabolism
    COCOR_02912
   00500 Starch and sucrose metabolism
    COCOR_02912
   00520 Amino sugar and nucleotide sugar metabolism
    COCOR_02912
Enzymes [BR:ccx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     COCOR_02912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3608043..3609182
Genome map
AA seq 379 aa AA seqDB search
MKTQTPDVDGELDDPRLARDGFDAASFRALLARYQRGELTESQSLAGPLEPPRPGDVQPL
PGEGTPAHEACRAVGEQAFREGAVAALVVAGGAGTRFGGVVKGLVPVLGEHTFLDLKLAE
ARRLGERLGRPVPVAVMTSFLTHEAIAAHLEARGLGRDVFLFRQQMLPRLTPEGALFREA
DGQLSFAPSGHGDVFRALRESGVGQTLRQRGVRCMYFSNVDNLAATLDPVVIGMHLQRGC
DMTVEVTPRANPSGALDAGAAPVRVGGQLQLVEKVDPTQHAFISTNNITFQLEAMLNEAL
PIPYRVVPKKVDGAPVLQFEQVTAEASSLTRPDGQPLLSVAFIEVGRTDPATSRFEPVKA
PDDLPRVVERLRSRLVALR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacccagaccccggatgtggatggagaacttgatgacccccggctcgcgcgtgac
ggcttcgacgcggccagcttccgggcgctgctcgcccgctaccagcgcggggagttgacg
gagtcccagtccctggcgggccccctcgaaccgccacggccgggggatgtccagccgctg
ccgggcgagggcacccctgcccacgaagcctgccgtgcggtgggggagcaggccttccgc
gagggcgcggtggccgccctggtggtggccggtggagcggggacacgttttggcggggtc
gtgaaggggctggtccccgtcctgggggagcacaccttcctggacctcaagctcgccgag
gcgcgccggttgggcgagcggctgggccgcccggtgccggtggcggtgatgacctccttt
ctcacgcacgaggccatcgccgcgcacctggaagcccgggggctggggcgggacgtgttc
ctcttccggcagcagatgcttccccggctcacgccggagggcgccttgttccgggaggcg
gatgggcagctgtcctttgccccttctggccacggggacgtgttccgcgccctgcgcgag
agcggggtggggcagacgctgcgccagcgcggtgtgcgctgcatgtacttctccaacgtg
gacaacctggcggcgacgctcgacccggtcgtcatcgggatgcacctgcaacggggctgc
gacatgacggtggaggtgacgccgcgggccaaccccagtggcgcgctggacgcgggcgcc
gcgccggtgcgcgtgggcggccagctccagctcgtggagaaggtggaccccacgcaacat
gccttcatctccaccaacaacatcaccttccaattggaggccatgctgaacgaagcgctg
cccattccctaccgggtggtgcccaagaaggtggacggcgcgcccgtcctccagttcgag
caggtgacggcggaggccagcagcctcacccgaccggatggccagccgctcctgtcggtc
gccttcatcgaggtggggcgcacggaccccgcgacgagccgcttcgaaccggtgaaggcc
ccggatgaccttccccgggtggtggagcgcctgcggtcgcggctggtggccctgcgttag

DBGET integrated database retrieval system