KEGG   Corallococcus coralloides: COCOR_03099Help
Entry
COCOR_03099       CDS       T01780                                 

Gene name
crt7
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ccx  Corallococcus coralloides
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    COCOR_03099 (crt7)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    COCOR_03099 (crt7)
   00650 Butanoate metabolism
    COCOR_03099 (crt7)
  Lipid metabolism
   00071 Fatty acid degradation
    COCOR_03099 (crt7)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_03099 (crt7)
   00310 Lysine degradation
    COCOR_03099 (crt7)
   00360 Phenylalanine metabolism
    COCOR_03099 (crt7)
   00380 Tryptophan metabolism
    COCOR_03099 (crt7)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCOR_03099 (crt7)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    COCOR_03099 (crt7)
   00281 Geraniol degradation
    COCOR_03099 (crt7)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COCOR_03099 (crt7)
   00627 Aminobenzoate degradation
    COCOR_03099 (crt7)
   00930 Caprolactam degradation
    COCOR_03099 (crt7)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     COCOR_03099 (crt7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3800642..3801415
Genome map
AA seq 257 aa AA seqDB search
MSEAPLVRYEVSRGVATLTLDSPRNRNALSRALVTQLLERLNAVGADPGVRAVVLAATGP
AFCAGADLSEMADGGAAKAPAVLLDVLRTIVTLPQPVVAKVAGQVRAGGIGIVGACDVAV
VAESVKFAFTEARIGVTPAVISLTTLPHLTSRAASRYFLTGEAFDAAEAARIGLITSAVP
DASLEGAVEQILETFRVSSPQGLRETKQLVAAGLRARIDSGGAEMVALSGRLFASEEAQE
GMLAFLERRPPAWAAPK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcaccgctcgtccggtacgaagtctctcgtggcgtcgcgaccctgacgctc
gattcgccgcgcaaccgcaatgcgctgtcgcgtgcgctcgtcacgcagctgctggagcgg
ctgaacgccgtgggcgccgatccgggcgtgcgcgcggtcgtcctcgcggccaccggtccg
gcgttctgcgcgggggcggacctctcggagatggcggacgggggcgccgcgaaggcaccg
gccgtgttgctcgacgtgctgcgcaccatcgtgacgctgccgcagcctgtcgtggcgaag
gtcgccgggcaggtgagggcgggcggcatcggcatcgtcggtgcgtgcgacgtggcggtc
gtcgcggagtccgtgaagttcgccttcaccgaggcgcgcatcggcgtgacgcccgcggtc
atctccctcaccacgctgccgcacctgaccagccgggcggcgagccgctacttcctcacc
ggtgaggccttcgacgcggccgaagccgcgcgcatcgggctcatcacctccgccgtgccg
gacgcgtccctggagggcgccgtcgagcagatcctggagacgttccgcgtgtcgtctccg
cagggcctgcgcgagaccaagcagctggtggccgccggcctgcgcgcgcgcatcgattcc
gggggcgccgagatggtcgcgctctccggccggctgttcgcctccgaagaggcccaggag
gggatgctcgccttcctggaacgccggcctcccgcgtgggccgcgccgaaatag

DBGET integrated database retrieval system