KEGG   Corallococcus coralloides: COCOR_03199Help
Entry
COCOR_03199       CDS       T01780                                 

Gene name
fdhA
Definition
(RefSeq) glutathione-independent formaldehyde dehydrogenase
Organism
ccx  Corallococcus coralloides
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3911179..3912321
Genome map
AA seq 380 aa AA seqDB search
MKALVYEGPRKVSVKEVPDAKIERPTDAVVRIRSTNICGSDLHMYEGRTDMESGRVLGHE
NLGEVVEVGSAVDKLKVGDWVAVPFNVSCGHCENCEHGLTAFCLKANPSGTAGAAYGFAD
MGPYNGGQAEYLRVPWADFNCLRLPEDAEEKQLDYVMLADIFPTGYHVTELAGLMPGESV
VIFGGGPVGQMAALSATIKSASKVMVVDWHPDRLALAEKIGAIPIDYSKVDPVERVKELT
NGKGADRGCECVGYQAHDPQGREHPNLTMNNLVKAVKFTGGIGVVGVFIPNDPGGKDTLA
RQGEIVFDWGMLWFKGQRVATGQCNVKAYNRQLRELIHLDKVKPSWIVSHTLPLDRAPDG
YLNFDKRDSGWTKVVLQPAA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcgtctacgaggggccgcgcaaggtcagtgtgaaagaagtgccggacgcg
aagattgagcgacccaccgatgcggtggtgcgcattcgcagtaccaacatctgcggctcc
gacctgcacatgtacgaaggccgaaccgacatggagtcgggccgggtgctcgggcacgag
aacctcggagaggtggtcgaggtcggctcggcggtggacaagctgaaggtgggcgattgg
gtggccgttcccttcaacgtcagctgtggccactgcgagaactgcgagcacggcctgacc
gccttctgcctcaaggccaacccgtcggggacggccggcgccgcctacggcttcgccgac
atggggccctacaacggagggcaggccgagtacctgcgcgtgccctgggccgacttcaac
tgcctgaggctgccggaggacgccgaggagaagcagctcgactacgtgatgctcgccgac
atcttccctaccggttaccacgtcaccgagctcgccgggctcatgccgggcgaatccgtc
gtcatcttcggtggagggcccgtgggacagatggccgcgctctccgccaccatcaagagc
gcgagcaaggtgatggtcgtcgactggcatccggaccggctcgctctcgccgagaagatt
ggcgccatccccatcgactactcgaaggtggaccccgtcgagcgggtgaaggagctcacc
aacggcaagggcgccgaccgcggctgcgagtgcgtgggctaccaggcgcacgacccacag
gggagggagcaccccaacctgacgatgaacaacctggtgaaggcggtgaagttcaccggc
ggcatcggcgtggtgggcgtcttcatccccaatgaccccggcggcaaggacaccttggcc
aggcagggtgaaatcgtcttcgactggggcatgctctggttcaaggggcagcgcgtggcg
accggccagtgcaacgtgaaggcctacaaccgccagctgcgcgaactcatccacctggac
aaggtgaagccctcgtggatcgtctcgcacacgctcccgctcgacagggcgccggacggc
tacctgaacttcgacaagcgcgacagcggctggaccaaggtcgtcctgcagccggccgcc
tga

DBGET integrated database retrieval system