KEGG   Corallococcus coralloides: COCOR_03587Help
Entry
COCOR_03587       CDS       T01780                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ccx  Corallococcus coralloides
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ccx00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ccx00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4422956..4423507
Genome map
AA seq 183 aa AA seqDB search
MSQNLYDIPLTGIDGAPRTLGQHKGKVLLVVNVASKCGLTPQYEGLQKLYASRQGQGLEV
LGFPANNFMGQEPGSEAEIQQFCTLKYDVTFPLYSKISVVGQDKHPLYHALTGAIPDATG
EGPMRANLKGYGIEANPKPEVQWNFEKFLVSRDGRVVGRFAPDVTAEDPRLVQAIDAELA
KPA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaacctctacgacatccccctcaccggcatcgacggcgctccccggacgctc
ggtcagcacaagggcaaggtcctgctggtggtgaacgtcgcctccaagtgcggcctgacg
ccccagtacgaaggcctgcagaagctctacgcgagccggcaggggcagggcctggaggtg
ctgggcttccccgcgaacaacttcatggggcaggagccgggcagcgaggcggagatccag
cagttctgcaccttgaagtacgacgtgaccttcccgctgtactcgaagatctccgtggtg
gggcaggacaagcacccgctctaccacgcgctgacgggcgccatcccggacgccacgggc
gaggggcccatgcgcgcgaacctcaagggctacggcattgaagccaacccgaagccggag
gtgcagtggaacttcgagaagttcctcgtcagccgggatggccgcgtcgtgggccgcttc
gctccggacgtgacggcggaggatccgcgactggtccaggccattgacgcggagctggcg
aagccggcctga

DBGET integrated database retrieval system