KEGG   Corallococcus coralloides: COCOR_03707Help
Entry
COCOR_03707       CDS       T01780                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ccx  Corallococcus coralloides
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ccx01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ccx00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4609143..4610444
Genome map
AA seq 433 aa AA seqDB search
MSASILKYQGALSSLEPDAQRRLLARTGESDALVASRVQALIARVRTEGDRALFDFAREF
DRVELAALEVPRERWNAALESIPSDVREALTRAARNIARAHAAQRPQSIEVETEPGVIVG
RRPDPLSRVGVYAPGGRAVYPSSVLMGVVPAKVAGVGEITVCSPPGPDGLPGAGVLAAAA
LAGADRVFALGGAGAVAALAYGTQSVPRVDRIVGPGNAYVAAAKLQVVDAVAIDAPAGPS
EILVVADASARPDAVARELLAQAEHDPEACCVALVVGAPLAQAVRDAVEQQARIARRGDI
VLSALGSRGAVLRIDSLEEAWPFVAEFAPEHLLLATAKPSEDLARVRNAGTVFVGQRASV
AFGDYLTGANHVLPTAGLARAYSGLSVLDFYRWTTWQRVTPEAAAAMADDVGTLADSEGL
FAHAAAARAWRVP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctccatcctcaagtaccagggcgcattgtcctcgctggagcctgacgcgcag
cggaggctgttggcccgcacgggggagtcggatgccctggtggcttcccgtgtccaggca
ctcattgcccgggtccgcacggaaggtgaccgggccctcttcgacttcgcgcgggagttc
gaccgcgtggagctggcggccctggaggttccgcgtgaacggtggaacgcggcgttggag
tcgattccctccgacgtgcgcgaggcactgacccgtgcggcgcgcaacatcgcccgggct
catgcggcgcagcggccccagtccatcgaagtggagacggagcccggggtcatcgtgggg
cgccggccggatccgctgagccgcgtcggtgtgtatgcccctggcggccgggcggtgtac
cccagcagcgtgctcatgggcgtggtccccgcgaaggtcgcgggcgtgggcgagatcacc
gtctgctcgccgccagggccggatggcttgcctggcgcgggtgtgctcgcggcggcagcg
ctcgcgggcgcggatcgggtgttcgcattgggcggtgcgggcgcggtggccgcgctggcc
tacggcacccagagcgttccccgcgtggaccgcatcgtcggaccgggcaacgcgtacgta
gcggccgcgaagcttcaagtggtggacgccgtcgccatcgacgcgcccgcgggcccgagc
gaaatcctggtggtcgccgacgcgagcgcccgtccggacgccgtggcgcgtgagttgctg
gcccaggcggagcacgaccccgaggcctgctgcgtggcgctggtggtgggcgctccgctg
gcgcaggcggtgcgggacgcggtggagcagcaggcccgcatcgcccggcgtggcgacatc
gtcctttccgcgctggggagccggggcgcggtgctgcgcatcgattcgctggaggaggcg
tggcccttcgtcgcggagttcgctccggagcacctgctgctcgcgacggcgaagccctcg
gaggacctggcgcgggttcgaaacgcgggcacggtgttcgtgggacagcgcgcgtcggtg
gcctttggtgactacctcaccggtgcgaaccacgtgctgcccacggcgggactggcccgg
gcgtactcggggctgagcgtgctggacttctaccggtggaccacgtggcaacgcgtgaca
ccggaagcggcggcggcgatggcggacgacgtggggacgctggcggacagcgagggcctc
ttcgctcacgcggccgcggctcgggcctggagggtgccgtga

DBGET integrated database retrieval system