KEGG   Corallococcus coralloides: COCOR_03849Help
Entry
COCOR_03849       CDS       T01780                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ccx  Corallococcus coralloides
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    COCOR_03849 (hemB)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     COCOR_03849 (hemB)
Exosome [BR:ccx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCOR_03849 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4792750..4793718
Genome map
AA seq 322 aa AA seqDB search
MAHPVHRPRRLRRSAALRDMVRETRLSPTDFIYPLFVVEGRDVRRPISSMPGIFNLSLEH
AVKEAKLAKSLGVPSVILFGIPDHKDARGTQAYATDGIVQRAIREIKAAEPDLQVIADVC
LCEYTDHGHCGVLDGNHVANDATLPLLAQMAVTCAQAGADIIAPSDMMDGRIGAIRKALD
EVKHQDTPIMAYSAKYASGFYGPFREAAQSTPQFGDRRGYQMDPGNVREAIRETALDVDE
GADFIMVKPALSYLDVIRALRENFDLPLAAYNVSGEYAMLKAAGQNGWVDYERVMLEVLT
SIKRAGADLVITYHALEAAKLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccccgtccaccgtccccgcaggctgcgccgctcagcggccctccgtgacatg
gtgagagagacgcgcctctcgcccacggacttcatctacccgctgttcgtcgtggaaggc
cgggacgtgcgccgtcccatctcctccatgccgggcatcttcaacctctcgttggagcac
gcggtgaaggaggcgaagctcgcgaagtcgctgggcgtgccctccgtcatcctcttcggc
atcccggaccacaaggacgcgcgcggcacccaggcgtacgcgacggacggcatcgtccag
cgcgccatccgggagatcaaggccgcggagccggacctccaggtcatcgcggacgtgtgc
ctctgcgagtacaccgaccacggccactgcggcgtgctggacggcaaccacgtggccaat
gacgccacgctgcccctgctggcccagatggccgtcacctgcgcgcaggcgggcgcggac
atcatcgccccgtcggacatgatggacggccgcatcggcgccatccgcaaggcgctggac
gaggtgaagcaccaggacacgcccatcatggcgtactcggcgaagtacgcctccggcttc
tacggcccgttccgtgaggccgcgcagagcacgccgcagttcggcgaccgccgcggctac
cagatggaccccggcaacgtgcgcgaggccatccgcgagacggcgctggacgtggacgag
ggcgcggacttcatcatggtgaagccggcgctgtcgtacctggacgtcatccgcgcgctg
cgtgagaacttcgatctgccgctcgccgcgtacaacgtctccggtgagtacgcgatgctc
aaggccgccgggcagaacggctgggtggactacgagcgcgtgatgttggaggtcctcaca
tccatcaagcgcgcgggcgccgacctggtcatcacctaccacgccctggaagcggccaag
ctcctgtag

DBGET integrated database retrieval system