KEGG   Corallococcus coralloides: COCOR_04690Help
Entry
COCOR_04690       CDS       T01780                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ccx  Corallococcus coralloides
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COCOR_04690 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COCOR_04690 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    COCOR_04690 (thrC)
Enzymes [BR:ccx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     COCOR_04690 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5923582..5924913)
Genome map
AA seq 443 aa AA seqDB search
MTAPALKAGYACSEGCGFTASLWDVVYRCPRCEGLLEVAHDEAALRAIPAAEWKRRFESR
FATSRLPDGSGVWGKREWALPELPVEDIVSLGEGRVPLKPLPRMAAELGLGSLMLKECGV
SPTGSFKDWGMTVLVSAVKHLRSRGTPIRAVACASTGDTSAALSAYAAAAGIPAVVFLPK
NKVSLAQLVQPIANGARVLSLDTDFDGCMKLVQAVTADTGLYLANSMNSLRIEGQKMIAI
ELCQDLGWEPPDWIVIPGGNLGNASALGRGLDLLFNLGLITRRPRIAVAQAQRANPLARA
FRGGFQDLVPMQAGATLASAIQIGNPVSFRRAVRMLRAFDGVVEEATESELANAAARADR
EGTFACPQTGVALAAVEKLAASGVMAKGASVAVVATAHGLKFADFKVGYHRETLSDVKAA
HANPPVELPADLSAVREALKDLG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcaccggcgctgaaggcgggctacgcgtgcagcgaggggtgcggcttcaccgcc
tcgctatgggacgtcgtctaccgctgtccgcgctgtgagggcctgctggaggtggcccac
gacgaagccgccctgcgcgccatccccgcggcggagtggaagcgccgcttcgagtcccgc
ttcgcgacgtcccggctgccggacggctctggcgtctggggcaagcgcgagtgggcgctg
cccgagctgccggtggaggacatcgtctcgctgggcgaagggcgcgtgccgctcaagccg
ctgcctcgcatggcggcggagctggggctgggctcgctgatgttgaaggagtgcggcgtc
tctccgacgggcagcttcaaggactgggggatgacggtcctggtgtccgcggtgaagcac
ctgcgctcgcgcggcacgcccatccgcgcggtggcgtgcgcgtccacgggcgacacgtcc
gcggcgctgtccgcgtacgccgcggcggcgggcatcccggcggtggtgttcctgccgaag
aacaaggtgtcgctcgcgcagctggtgcagcccatcgccaatggggcgcgcgtgctgtcg
ctggacacggacttcgacggctgcatgaagctggtgcaggcggtgacggcggacacgggg
ctgtacctggcgaactcgatgaactcgctgcgcatcgagggccagaagatgatcgccatc
gagctgtgccaggacctgggctgggagccgccggactggatcgtcatcccgggcggcaac
ctgggcaacgcgagcgccctgggccggggtctggatctgctcttcaacctggggctcatc
acccgccggccgcgcatcgcggtggcgcaggcgcagcgggcgaaccccctggcgcgcgcc
ttccggggcggcttccaggacttggtgcccatgcaggcgggagcgacgctcgcgtccgcc
atccagattggcaacccggtgtccttccgccgcgcggtgcggatgctgcgcgcgttcgac
ggcgtggtggaggaggcgacggagtcggagctggccaacgcggcggcccgggcggaccgc
gagggcaccttcgcctgtccgcagacgggcgtcgcgctggcggcggtggagaagctggcc
gcgtcgggcgtgatggcgaagggcgccagcgtcgcggtggtggccaccgcgcacgggctg
aagttcgcggacttcaaggtgggctaccaccgggagacgctgagcgacgtgaaggccgcg
cacgcgaaccctccggtggagctgcccgcggacctgtccgccgtgcgcgaggccctgaag
gacctgggctga

DBGET integrated database retrieval system