KEGG   Corallococcus coralloides: COCOR_04690Help
Entry
COCOR_04690       CDS       T01780                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ccx  Corallococcus coralloides
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ccx01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ccx00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ccx00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5923582..5924913)
Genome map
AA seq 443 aa AA seqDB search
MTAPALKAGYACSEGCGFTASLWDVVYRCPRCEGLLEVAHDEAALRAIPAAEWKRRFESR
FATSRLPDGSGVWGKREWALPELPVEDIVSLGEGRVPLKPLPRMAAELGLGSLMLKECGV
SPTGSFKDWGMTVLVSAVKHLRSRGTPIRAVACASTGDTSAALSAYAAAAGIPAVVFLPK
NKVSLAQLVQPIANGARVLSLDTDFDGCMKLVQAVTADTGLYLANSMNSLRIEGQKMIAI
ELCQDLGWEPPDWIVIPGGNLGNASALGRGLDLLFNLGLITRRPRIAVAQAQRANPLARA
FRGGFQDLVPMQAGATLASAIQIGNPVSFRRAVRMLRAFDGVVEEATESELANAAARADR
EGTFACPQTGVALAAVEKLAASGVMAKGASVAVVATAHGLKFADFKVGYHRETLSDVKAA
HANPPVELPADLSAVREALKDLG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcaccggcgctgaaggcgggctacgcgtgcagcgaggggtgcggcttcaccgcc
tcgctatgggacgtcgtctaccgctgtccgcgctgtgagggcctgctggaggtggcccac
gacgaagccgccctgcgcgccatccccgcggcggagtggaagcgccgcttcgagtcccgc
ttcgcgacgtcccggctgccggacggctctggcgtctggggcaagcgcgagtgggcgctg
cccgagctgccggtggaggacatcgtctcgctgggcgaagggcgcgtgccgctcaagccg
ctgcctcgcatggcggcggagctggggctgggctcgctgatgttgaaggagtgcggcgtc
tctccgacgggcagcttcaaggactgggggatgacggtcctggtgtccgcggtgaagcac
ctgcgctcgcgcggcacgcccatccgcgcggtggcgtgcgcgtccacgggcgacacgtcc
gcggcgctgtccgcgtacgccgcggcggcgggcatcccggcggtggtgttcctgccgaag
aacaaggtgtcgctcgcgcagctggtgcagcccatcgccaatggggcgcgcgtgctgtcg
ctggacacggacttcgacggctgcatgaagctggtgcaggcggtgacggcggacacgggg
ctgtacctggcgaactcgatgaactcgctgcgcatcgagggccagaagatgatcgccatc
gagctgtgccaggacctgggctgggagccgccggactggatcgtcatcccgggcggcaac
ctgggcaacgcgagcgccctgggccggggtctggatctgctcttcaacctggggctcatc
acccgccggccgcgcatcgcggtggcgcaggcgcagcgggcgaaccccctggcgcgcgcc
ttccggggcggcttccaggacttggtgcccatgcaggcgggagcgacgctcgcgtccgcc
atccagattggcaacccggtgtccttccgccgcgcggtgcggatgctgcgcgcgttcgac
ggcgtggtggaggaggcgacggagtcggagctggccaacgcggcggcccgggcggaccgc
gagggcaccttcgcctgtccgcagacgggcgtcgcgctggcggcggtggagaagctggcc
gcgtcgggcgtgatggcgaagggcgccagcgtcgcggtggtggccaccgcgcacgggctg
aagttcgcggacttcaaggtgggctaccaccgggagacgctgagcgacgtgaaggccgcg
cacgcgaaccctccggtggagctgcccgcggacctgtccgccgtgcgcgaggccctgaag
gacctgggctga

DBGET integrated database retrieval system