KEGG   Corallococcus coralloides: COCOR_04887Help
Entry
COCOR_04887       CDS       T01780                                 

Gene name
cheB1
Definition
Chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ccx  Corallococcus coralloides
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    COCOR_04887 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    COCOR_04887 (cheB1)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     COCOR_04887 (cheB1)
Two-component system [BR:ccx02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   COCOR_04887 (cheB1)
Bacterial motility proteins [BR:ccx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    COCOR_04887 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6169034..6170098
Genome map
AA seq 354 aa AA seqDB search
MNAIRVLVVDDAAVVRRQVSLLLGAAPGLEVVATAPNGRIALAKVEQFQPDVVLLDLEMP
ELDGLETLKLLRQRDPELPVVMFSALTERAGVLTLEALALGARDYVTKPTSVGGMNITVE
AVRDELVRKLKALNVRTPSAPPSPSPVPREPVARPRMPARVEAIVIGASTGGPGALVRLV
SALPADLPVPVLIVQHMPPLFTRLLAERLQGVTPLTVREAVTGASVQAGEVWVAPGDFHL
AVCRDATGVRLLTHQGPAENACRPAVDLLFRSAAEVYGAGVLAVVLTGMGQDGLRGCRRV
NEAGGQVVVQDQASCVVGSMPGAVEQAGLADAVMPLEALALELARRVDARGRRT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccatccgggtcctggtggtggacgacgcggccgtggtgcggcgccaggtgtcg
ctgctgctgggcgcggccccgggcctggaggtcgtcgccaccgcgcccaatggccgcatc
gccctggcgaaggtggagcagttccaaccggacgtcgtgctgttggacctggagatgccg
gagctggacgggctggagacgctgaagctcctgcgccagcgtgacccggagctgcccgtg
gtgatgttcagcgcgctcaccgaacgcgcgggcgtgctgaccctggaggcgctcgcgctg
ggggcccgcgactacgtgacgaagcccacgtccgtgggagggatgaacatcaccgtggag
gccgtgcgggatgagctggtgcgcaagctcaaggcgctgaacgtgcgcacgccgtccgct
ccgccttcgccgtcaccggtgcctcgcgagcccgtggcccggccgcgaatgcccgcgcgg
gtggaggccatcgtcatcggcgcgtccaccggcggcccgggcgcgctggtgcgcctggtg
tccgcgctccccgcggacctgccggtgccggtgctcatcgtgcagcacatgccgcccctc
ttcacccggctgctcgcggagcggttgcagggcgtgacaccgctcaccgtgcgggaagcg
gtgacgggcgcctccgtgcaggcgggcgaggtgtgggtcgcccccggcgacttccacctg
gccgtgtgccgggatgcgacgggcgtgcggctgctcacacaccaggggccggcggagaac
gcgtgccgtccggcggtggacctgctcttccgctccgcggcggaggtgtacggcgcgggg
gtgctggcggtggtgctcaccggcatgggccaggacgggctgcgcggctgccggcgggtg
aacgaggcaggcggacaggtggtggtacaggaccaggccagctgcgtcgtcggcagcatg
ccgggcgcggtggaacaggcggggctggcggatgccgtgatgcccctggaggcgctggcg
ttggagctggcgcggcgcgtggatgcgcgcggacggaggacctga

DBGET integrated database retrieval system