KEGG   Corallococcus coralloides: COCOR_05184Help
Entry
COCOR_05184       CDS       T01780                                 

Gene name
srfJ
Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ccx  Corallococcus coralloides
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ccx00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6532936..6534828
Genome map
AA seq 630 aa AA seqDB search
MSSWLSRVPLQGLLLAASTLLPPVASAANETVRVWLTTTSGSALAKKLNAEANKAFGPET
GSATAIDVNEGVTYQTLDGFGGALTDSSAWLIFNSPQRTAIMNDLFSVSAGAGQSAIRLP
MGASDFSRNNYTYDDTCCDLNDFSVGHDTAYILPLLKQARAINPEVKVFAVPWSAPAWMK
FNNSLTGGGYLRNDLYGTYANYFVRFVQAYQANGVPIHALSLQNEPHNANGGYATMQMES
NDQSVFAAQYLRPALNAAGFNGVKVLAWDHNWHDGSGPAGYPHEVMAYNGGQAQNAVAGV
AYHCYESPEGSYSVQSAFHDAYPAKEVHFTECTGGFWATNAAANLEWALQNNLFGPLRHW
SRTSFYWNLALDPNHGPRVGGCADCRGMFTVDNANGTYTRNEEYYAWAHLAKVVRPGAVR
VGATSLGNNNVETLAFRNPDGSRALIALNSNDGATLSFKVRWNGQAFEYTLPPRSVASFQ
WGGTSGPQGPWYRLVNKATGKCVDIVGPSAADGTGLHQWACHTGASQQWSLVATDSGYSR
LVSRHSGKAVDVADASQADGARVQQWSWAGGANQQFKPVATTGGYTRFEARHSGKVLDVS
NCWSSGDGAAVQQWVWSNNDCQQFRLEAMP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctggctgtcccgagtccccctgcagggcctgctgctggccgcctccaccctc
ctgccccctgtcgcgagcgcggcgaacgagaccgtgcgggtgtggctgacgacgacgtcc
ggcagcgcgctggcgaagaagctcaacgcggaggcgaacaaggcgttcggtccggagacg
ggcagcgccacggccatcgacgtgaacgaaggcgtgacgtaccagaccctcgacgggttt
ggcggcgcgctcacggattcgtccgcgtggctcatcttcaactcgccgcagcgcacggcc
atcatgaacgacctgttcagcgtgagcgcgggcgcgggccagagcgccatccgcctgccc
atgggcgcgtccgacttctcgcgcaacaactacacctacgacgacacctgctgcgacctg
aacgacttctccgtgggtcacgacacggcgtacatcctgccgctcttgaagcaggcgcgc
gccatcaacccggaggtgaaggtgttcgcggtgccgtggagcgcgcccgcgtggatgaag
ttcaacaactcgctcaccggcggcggctacctgcgcaatgacctgtacggcacctatgcg
aactacttcgtgcgcttcgtgcaggcctaccaggcgaacggcgtgcccatccacgcgctg
agcctccagaacgagccgcacaacgccaacggcggctacgcgacgatgcagatggagtcc
aacgaccaatccgtcttcgccgcccagtatctgcgccccgcgctcaacgccgcgggcttc
aacggcgtgaaggtgctggcgtgggaccacaactggcacgacggctcgggcccggcgggc
tatccgcacgaagtgatggcctacaacggcgggcaggcgcagaacgccgtcgcgggcgtg
gcctaccactgctacgagagccccgagggcagctacagcgtccagtccgcgttccatgac
gcctaccccgccaaggaggtgcacttcaccgagtgcaccggcggattctgggccaccaac
gccgcggcgaacctggagtgggcgctgcagaacaacctcttcgggccgctgcgccactgg
tcgcgcacgtccttctactggaacctggccctggacccgaaccacgggccgcgcgtgggc
ggctgcgcggactgccggggcatgttcaccgtggacaacgccaacggcacgtacacgcgc
aacgaggagtactacgcgtgggcgcacctggcgaaggtggtgcggccgggcgcggtgcgc
gtgggcgccacgtcgctgggcaacaacaacgtcgagacgctcgccttccgcaacccggac
ggctcgcgtgcgctcatcgcgctgaactcgaatgacggcgccacgctgtccttcaaggtc
cgctggaacggccaggccttcgagtacacgctgccgccgcgctcggtggcgtccttccag
tggggcgggacgtccggcccgcaggggccgtggtaccggctggtcaacaaggccaccgga
aagtgcgtggacatcgtgggcccgtccgcggcggacggcaccgggctgcaccagtgggcg
tgccacacgggcgcaagccagcagtggtccctggtggccacggacagcggctactcgcgg
ctggtgtcgcgccacagcggcaaggcggtggacgtggcggacgcaagccaggcggacggc
gcgcgcgtgcagcagtggtcctgggcgggcggcgccaaccagcagttcaagccggtggcc
accaccggcggctacacccgcttcgaggcccgccacagcggcaaggtgctggacgtgagc
aactgctggagcagcggcgacggggccgctgtccagcaatgggtctggtccaacaacgac
tgccagcagttccgcctggaagccatgccctga

DBGET integrated database retrieval system