KEGG   Corallococcus coralloides: COCOR_05184Help
Entry
COCOR_05184       CDS       T01780                                 

Gene name
srfJ
Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ccx  Corallococcus coralloides
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    COCOR_05184 (srfJ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    COCOR_05184 (srfJ)
Enzymes [BR:ccx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     COCOR_05184 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6532936..6534828
Genome map
AA seq 630 aa AA seqDB search
MSSWLSRVPLQGLLLAASTLLPPVASAANETVRVWLTTTSGSALAKKLNAEANKAFGPET
GSATAIDVNEGVTYQTLDGFGGALTDSSAWLIFNSPQRTAIMNDLFSVSAGAGQSAIRLP
MGASDFSRNNYTYDDTCCDLNDFSVGHDTAYILPLLKQARAINPEVKVFAVPWSAPAWMK
FNNSLTGGGYLRNDLYGTYANYFVRFVQAYQANGVPIHALSLQNEPHNANGGYATMQMES
NDQSVFAAQYLRPALNAAGFNGVKVLAWDHNWHDGSGPAGYPHEVMAYNGGQAQNAVAGV
AYHCYESPEGSYSVQSAFHDAYPAKEVHFTECTGGFWATNAAANLEWALQNNLFGPLRHW
SRTSFYWNLALDPNHGPRVGGCADCRGMFTVDNANGTYTRNEEYYAWAHLAKVVRPGAVR
VGATSLGNNNVETLAFRNPDGSRALIALNSNDGATLSFKVRWNGQAFEYTLPPRSVASFQ
WGGTSGPQGPWYRLVNKATGKCVDIVGPSAADGTGLHQWACHTGASQQWSLVATDSGYSR
LVSRHSGKAVDVADASQADGARVQQWSWAGGANQQFKPVATTGGYTRFEARHSGKVLDVS
NCWSSGDGAAVQQWVWSNNDCQQFRLEAMP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctggctgtcccgagtccccctgcagggcctgctgctggccgcctccaccctc
ctgccccctgtcgcgagcgcggcgaacgagaccgtgcgggtgtggctgacgacgacgtcc
ggcagcgcgctggcgaagaagctcaacgcggaggcgaacaaggcgttcggtccggagacg
ggcagcgccacggccatcgacgtgaacgaaggcgtgacgtaccagaccctcgacgggttt
ggcggcgcgctcacggattcgtccgcgtggctcatcttcaactcgccgcagcgcacggcc
atcatgaacgacctgttcagcgtgagcgcgggcgcgggccagagcgccatccgcctgccc
atgggcgcgtccgacttctcgcgcaacaactacacctacgacgacacctgctgcgacctg
aacgacttctccgtgggtcacgacacggcgtacatcctgccgctcttgaagcaggcgcgc
gccatcaacccggaggtgaaggtgttcgcggtgccgtggagcgcgcccgcgtggatgaag
ttcaacaactcgctcaccggcggcggctacctgcgcaatgacctgtacggcacctatgcg
aactacttcgtgcgcttcgtgcaggcctaccaggcgaacggcgtgcccatccacgcgctg
agcctccagaacgagccgcacaacgccaacggcggctacgcgacgatgcagatggagtcc
aacgaccaatccgtcttcgccgcccagtatctgcgccccgcgctcaacgccgcgggcttc
aacggcgtgaaggtgctggcgtgggaccacaactggcacgacggctcgggcccggcgggc
tatccgcacgaagtgatggcctacaacggcgggcaggcgcagaacgccgtcgcgggcgtg
gcctaccactgctacgagagccccgagggcagctacagcgtccagtccgcgttccatgac
gcctaccccgccaaggaggtgcacttcaccgagtgcaccggcggattctgggccaccaac
gccgcggcgaacctggagtgggcgctgcagaacaacctcttcgggccgctgcgccactgg
tcgcgcacgtccttctactggaacctggccctggacccgaaccacgggccgcgcgtgggc
ggctgcgcggactgccggggcatgttcaccgtggacaacgccaacggcacgtacacgcgc
aacgaggagtactacgcgtgggcgcacctggcgaaggtggtgcggccgggcgcggtgcgc
gtgggcgccacgtcgctgggcaacaacaacgtcgagacgctcgccttccgcaacccggac
ggctcgcgtgcgctcatcgcgctgaactcgaatgacggcgccacgctgtccttcaaggtc
cgctggaacggccaggccttcgagtacacgctgccgccgcgctcggtggcgtccttccag
tggggcgggacgtccggcccgcaggggccgtggtaccggctggtcaacaaggccaccgga
aagtgcgtggacatcgtgggcccgtccgcggcggacggcaccgggctgcaccagtgggcg
tgccacacgggcgcaagccagcagtggtccctggtggccacggacagcggctactcgcgg
ctggtgtcgcgccacagcggcaaggcggtggacgtggcggacgcaagccaggcggacggc
gcgcgcgtgcagcagtggtcctgggcgggcggcgccaaccagcagttcaagccggtggcc
accaccggcggctacacccgcttcgaggcccgccacagcggcaaggtgctggacgtgagc
aactgctggagcagcggcgacggggccgctgtccagcaatgggtctggtccaacaacgac
tgccagcagttccgcctggaagccatgccctga

DBGET integrated database retrieval system