KEGG   Corallococcus coralloides: COCOR_05190Help
Entry
COCOR_05190       CDS       T01780                                 

Definition
threonine dehydrogenase-related Zn-dependent dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ccx  Corallococcus coralloides
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ccx01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:ccx00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ccx00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6540570..6541793
Genome map
AA seq 407 aa AA seqDB search
MLAVVYKENSQVKVEEVEDPKLESPTDCVIRVTSAGICGSDLHMYEGRTASKAGQVFGHE
NMGVVEQVGPGVRSIKKGDRVVLPFNIACGTCFDCVRGRTEACLVANPEAPHAGYGYAGM
GPYRGGQAELLRVPWADYNCLKIPGQPGDELEDDFLLLSDVFPTAYHGTELANVRPGATV
AVFGAGPVGLLAGYCALLRGASEVYVVDSVPERLAKVKEMGAIPIDFTKGDPVKQIIDLR
RGNPLIMGALRAGEEKAMGVMCGIDAVGYQSRDIKGADAHGGREKPTQVLEQLVELVNPT
GSIGVIGVYMAPDPGAPDENAKQGIYPLPWAKVFDKGITVGTGQTPVKRYNHFLRDLIIA
GRARPSMIVSHRLPLQDAPDAYKKFDARKDGYTKVILKPQLSPKARA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgtcgtctacaaagagaacagccaggtgaaggtggaggaggtcgaggatccg
aagctggagtctcccaccgactgcgtcatccgcgtcacctccgccggcatctgtggaagt
gacctgcacatgtacgagggccgcaccgcgtccaaggccggacaggtgttcggccacgag
aacatgggcgtcgtggagcaggtaggccccggcgtcaggagcatcaagaagggcgaccgc
gtggtgctgcccttcaacatcgcctgcggcacctgcttcgactgcgtgcgcggccgcacc
gaggcgtgcctcgtcgccaatccggaagcgccgcacgcgggctacggctacgcgggcatg
ggcccgtaccgcggtggacaggcggagctgctccgggtgccctgggcggactacaactgc
ctgaagattcccgggcagccgggcgacgagttggaggacgacttcctcctcttgtcggac
gtgttcccgaccgcgtaccacggcaccgagcttgcgaacgtgcggccgggcgccaccgtg
gccgtcttcggcgcggggccggtgggcctgctcgccggctactgcgcgctcttgcgcggc
gcttcggaggtctacgtggtggacagcgtcccggagcgcctggccaaggtgaaggagatg
ggcgccatccccatcgacttcacgaagggcgacccggtgaagcagatcatcgacctgcgc
cgcggcaacccgctcatcatgggcgcgctgcgcgccggtgaggagaaggccatgggcgtg
atgtgcggcatcgacgccgtgggctaccagtcgcgcgacatcaaaggcgcggacgcgcac
ggcggccgggagaagcccacccaggtgctggagcagctggtggagctggtgaaccccacg
ggctccattggcgtcattggcgtctacatggccccggaccccggcgcgccggacgagaac
gcgaagcagggcatctacccgctgccgtgggccaaggtgttcgacaagggcatcaccgtg
ggcaccggccagacgccggtgaagcgctacaaccacttcctgagggacctcatcatcgcg
ggccgcgccaggccgagcatgatcgtcagccaccgcctgccgctgcaggacgcgccggac
gcatacaagaagttcgacgcacgcaaggacggctacaccaaggtcatcctcaagccccag
ctgagccccaaggcccgcgcttag

DBGET integrated database retrieval system