KEGG   Corallococcus coralloides: COCOR_05190Help
Entry
COCOR_05190       CDS       T01780                                 

Definition
threonine dehydrogenase-related Zn-dependent dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ccx  Corallococcus coralloides
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCOR_05190
  Energy metabolism
   00680 Methane metabolism
    COCOR_05190
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    COCOR_05190
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     COCOR_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6540570..6541793
Genome map
AA seq 407 aa AA seqDB search
MLAVVYKENSQVKVEEVEDPKLESPTDCVIRVTSAGICGSDLHMYEGRTASKAGQVFGHE
NMGVVEQVGPGVRSIKKGDRVVLPFNIACGTCFDCVRGRTEACLVANPEAPHAGYGYAGM
GPYRGGQAELLRVPWADYNCLKIPGQPGDELEDDFLLLSDVFPTAYHGTELANVRPGATV
AVFGAGPVGLLAGYCALLRGASEVYVVDSVPERLAKVKEMGAIPIDFTKGDPVKQIIDLR
RGNPLIMGALRAGEEKAMGVMCGIDAVGYQSRDIKGADAHGGREKPTQVLEQLVELVNPT
GSIGVIGVYMAPDPGAPDENAKQGIYPLPWAKVFDKGITVGTGQTPVKRYNHFLRDLIIA
GRARPSMIVSHRLPLQDAPDAYKKFDARKDGYTKVILKPQLSPKARA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgtcgtctacaaagagaacagccaggtgaaggtggaggaggtcgaggatccg
aagctggagtctcccaccgactgcgtcatccgcgtcacctccgccggcatctgtggaagt
gacctgcacatgtacgagggccgcaccgcgtccaaggccggacaggtgttcggccacgag
aacatgggcgtcgtggagcaggtaggccccggcgtcaggagcatcaagaagggcgaccgc
gtggtgctgcccttcaacatcgcctgcggcacctgcttcgactgcgtgcgcggccgcacc
gaggcgtgcctcgtcgccaatccggaagcgccgcacgcgggctacggctacgcgggcatg
ggcccgtaccgcggtggacaggcggagctgctccgggtgccctgggcggactacaactgc
ctgaagattcccgggcagccgggcgacgagttggaggacgacttcctcctcttgtcggac
gtgttcccgaccgcgtaccacggcaccgagcttgcgaacgtgcggccgggcgccaccgtg
gccgtcttcggcgcggggccggtgggcctgctcgccggctactgcgcgctcttgcgcggc
gcttcggaggtctacgtggtggacagcgtcccggagcgcctggccaaggtgaaggagatg
ggcgccatccccatcgacttcacgaagggcgacccggtgaagcagatcatcgacctgcgc
cgcggcaacccgctcatcatgggcgcgctgcgcgccggtgaggagaaggccatgggcgtg
atgtgcggcatcgacgccgtgggctaccagtcgcgcgacatcaaaggcgcggacgcgcac
ggcggccgggagaagcccacccaggtgctggagcagctggtggagctggtgaaccccacg
ggctccattggcgtcattggcgtctacatggccccggaccccggcgcgccggacgagaac
gcgaagcagggcatctacccgctgccgtgggccaaggtgttcgacaagggcatcaccgtg
ggcaccggccagacgccggtgaagcgctacaaccacttcctgagggacctcatcatcgcg
ggccgcgccaggccgagcatgatcgtcagccaccgcctgccgctgcaggacgcgccggac
gcatacaagaagttcgacgcacgcaaggacggctacaccaaggtcatcctcaagccccag
ctgagccccaaggcccgcgcttag

DBGET integrated database retrieval system