KEGG   Corallococcus coralloides: COCOR_05244Help
Entry
COCOR_05244       CDS       T01780                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ccx  Corallococcus coralloides
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCOR_05244 (tpiA)
   01230 Biosynthesis of amino acids
    COCOR_05244 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_05244 (tpiA)
   00051 Fructose and mannose metabolism
    COCOR_05244 (tpiA)
   00562 Inositol phosphate metabolism
    COCOR_05244 (tpiA)
Enzymes [BR:ccx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COCOR_05244 (tpiA)
Exosome [BR:ccx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   COCOR_05244 (tpiA)
  Exosomal proteins of bladder cancer cells
   COCOR_05244 (tpiA)
  Exosomal proteins of melanoma cells
   COCOR_05244 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6613600..6614361)
Genome map
AA seq 253 aa AA seqDB search
MARRKIVAGNWKMNKTVPEALALVRELRGAVAAMGDKVEVAIAPPFVALQPLHVALEGAP
LQLAAQNCHWESSGAFTGEISAPMLAELGCAYVIVGHSERRQFFGETDATVNKRAKAVKA
AGMTPIVCVGETLAERESNQTLTVVERQVRGALEGFSGADVATFVLAYEPVWAIGTGRTA
TTAQAQEVHAAIRGLLTRMYDEGTAERVRIQYGGSVKPDNAAELLGQPDVDGALVGGASL
KAADFVAIVKAAG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcggaagatcgtcgctggcaactggaagatgaacaagacggtgccggaagcg
ctcgcgctggtgcgggagcttcgcggcgcggtggcggcaatgggcgacaaggtggaggtg
gccatcgcgcctccgttcgtggcgttgcagcccctgcacgtcgcgctggagggggcgccc
ctccaactggcggcgcagaactgccactgggagtcctcgggcgccttcacgggcgaaatc
agcgcgccgatgctggcggagctgggctgtgcctacgtcatcgtggggcactcggagcgc
cggcagttcttcggtgagacggacgccacggtgaacaagcgggccaaggcggtgaaggcc
gccgggatgacgcccatcgtctgcgtgggcgagacgctggccgagcgcgagtcgaaccag
acgctgacggtggtggagcgccaggtgcgcggcgcgctggagggcttctccggggcggac
gtggcgaccttcgtgctggcgtacgagccggtgtgggcgattgggacgggccggacggcg
acgacggcgcaggcgcaggaggtccacgcggcgatccggggccttctgacccggatgtac
gacgaggggacggccgagcgggtccggatccagtacggcggcagcgtgaagccggacaac
gcggcggaattgctgggtcagccggacgtggacggggcgctcgtggggggagcgagcctc
aaggcggcggacttcgtggccatcgtgaaggcggctggctga

DBGET integrated database retrieval system