KEGG   Corallococcus coralloides: COCOR_05376Help
Entry
COCOR_05376       CDS       T01780                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00010  Glycolysis / Gluconeogenesis
ccx00020  Citrate cycle (TCA cycle)
ccx00620  Pyruvate metabolism
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01200  Carbon metabolism
Module
ccx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_05376 (pdhC)
   00020 Citrate cycle (TCA cycle)
    COCOR_05376 (pdhC)
   00620 Pyruvate metabolism
    COCOR_05376 (pdhC)
Enzymes [BR:ccx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     COCOR_05376 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H DUF2118 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFE09769
UniProt: H8MXF8
Position
complement(6761613..6763256)
Genome map
AA seq 547 aa AA seqDB search
MATPIQMPSLSPTMKEGKIVKWLKKVGDKISSGDAIAEVETDKSNLEVEAFDDGYLIEIA
VPEGEVATVGSPIGFLGAKGEKATGGAPSAPAPQKAEAPKAAAPAAAPKPPEQAPAPAAS
GAGEGIAILMPSLSPTMTEGKIVKWLKKEGDKVSSGDAIAEVETDKSNLEVEAYDDGTLG
RITVQAGDMAKVGAPIAFLTPKGAKAGTSAPAAAPQAPAAPKAPAAAAPSAPAGGQVVPL
RREPQAPASGAGGRLRASPLAKRMAQERGLDISQVRGTGPLGRVVKRDVEQALGQGLAKA
PAQAPAAKKAGAPPEVRAFGTRPEPQAVPMSSMRKVIGQRMSEVKPGVPHFYLTVEVEMD
AAVKIREEAKALDLKVSVNDIIVKAAAIALRRSPKMNVSLQGDQVLHYGTVDVGIAVAIE
DGLITPIIRDADLKGLQAISAESRDMAERARKRALKPAEYNGGSLTVSNLGMYGIDQFIA
VINPPQSAIIAVGAVAEKAVVRDGQLAVRKMMTVTLSGDHRVIDGATGAEYLRELKGLLE
HPSRLLF
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcccatccagatgcccagcctttccccgacgatgaaggaggggaagatcgtc
aaatggctgaagaaggtgggagacaagatctcctccggagacgccatcgccgaggttgag
acggacaagtccaacctcgaggtggaagccttcgacgacggctacctcattgaaatcgcc
gtgcccgagggcgaggtcgccacggtgggttcgcccatcggcttcctcggcgccaagggt
gagaaggccaccggtggtgcgccttcggccccggcgccccagaaggcggaggcccccaag
gccgccgctcccgccgccgccccgaagcctcccgagcaggccccggctcccgccgccagc
ggcgcgggcgaggggattgccatcctgatgccgtccctctccccgacgatgacggagggg
aagatcgtcaagtggctgaagaaggagggggacaaggtctcctccggtgacgccatcgcc
gaggtggagacggacaagtccaacctcgaggtggaggcgtacgacgacggcacgctcggc
cgcatcaccgtgcaggcgggtgacatggccaaggtcggcgcgcccatcgcgttcctcacg
cccaagggcgccaaggccgggacctccgctccggcggccgcgccccaggctccggccgct
cccaaggctccggctgccgcggctccgtccgcgcccgctgggggacaggtcgttccgctg
cgccgcgagccccaggccccggcctccggcgctggcggccggctgcgcgccagcccgctg
gcgaagcgcatggcccaggagcgcgggctggacatcagccaggtgcgcggcacgggtccg
ctgggccgcgtggtgaagcgcgacgtggagcaggcgctgggccagggcctggcgaaggct
cccgctcaggcgccggcggcgaagaaggccggagccccgccggaggttcgcgccttcggt
acgcgtccggagccgcaggcagtgcccatgtcctccatgcgcaaggtcattggccagcgc
atgtcggaagtgaagcccggcgtgccgcacttctacctgacggtggaagtggagatggac
gccgcggtgaagatccgcgaggaggccaaggcgctggacctcaaggtgtccgtcaacgac
atcatcgtgaaggcggcggccatcgcgctgcgccgttcaccgaagatgaacgtgtcgctc
cagggcgaccaggtgctgcactacggcaccgtggacgtgggcatcgccgtcgccatcgag
gatgggctgatcacgcccatcatccgcgacgcggacctcaagggcctgcaggccatctcc
gccgagtcccgcgacatggcggagcgcgcccgcaagcgcgccctgaagccggccgagtac
aacggcggctcgctcacggtgagcaacctgggcatgtacggcatcgaccagttcatcgcc
gtcatcaacccgccccagtccgccatcatcgcggtgggcgccgtggcggagaaggccgtg
gtgcgtgacggccagctggcggtgcgcaagatgatgacggtgacgctgtcgggtgaccac
cgcgtcatcgacggggccaccggcgcggagtacctccgcgagctgaaggggctcttggag
cacccctcgcggctgctgttctag

DBGET integrated database retrieval system