KEGG   Corallococcus coralloides: COCOR_05520Help
Entry
COCOR_05520       CDS       T01780                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00010  Glycolysis / Gluconeogenesis
ccx00620  Pyruvate metabolism
ccx00640  Propanoate metabolism
ccx00680  Methane metabolism
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCOR_05520 (acsA)
   00620 Pyruvate metabolism
    COCOR_05520 (acsA)
   00640 Propanoate metabolism
    COCOR_05520 (acsA)
  Energy metabolism
   00680 Methane metabolism
    COCOR_05520 (acsA)
Enzymes [BR:ccx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     COCOR_05520 (acsA)
Lipid biosynthesis proteins [BR:ccx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   COCOR_05520 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFE07964
UniProt: H8MZ84
Position
complement(6941197..6943149)
Genome map
AA seq 650 aa AA seqDB search
MADPQEIVSVLTESRVFPPPEDFSRRAHIRGMQDYQRLWDEAAKDPDTYWGDRAREELYW
KVPFQTVLDWKPPHARWFVEGKTNLAYNCLDRHLPKLQDKPAILFEGEPGDRRSITYGEL
SQQVNRLANGLKSLGVKKGDRVGIYLPMVPEAAVAMLACARLGAVHSVVFGGFSAEALQD
RMKDAGAKVLLTADGGWRKGAVVPLMRNVEAALPNAPSIEKVVVLTRTGDGKLPEGPKFL
AWDALVKGQSDVCEPEWVESEHPLFILYTSGSTGKPKGVLHTTAGYAVMASLTTRWVFDL
RDDDVYWCTADVGWVTGHSYVVYGPLMNGVTTIIYEGAPTQPGPDRFWDIIERYKATILY
TAPTAIRAFMRLGDEPVKKHDLSSLRLLGSVGEPINPEAWMWYREVIGGGRCPVVDTWWQ
TETGSIMISPLPGATPTKPGSATFPLPGIHAEILDREGKRVPRGQGGLLFVTKPWPSMLR
TVYGDPERYVNTYFSELPGMYFTGDGARTDADGYVWLMGRVDDVVNVAGHRLGTAEVESA
LVAHPKVSEAAVVGRPDDLKGTALVAFVTLKQGHPPSDALKKELAVHVGKEIGAIARPDE
IRFAEGLPKTRSGKIMRRLLRDVAAGKQSSQDTTTLEDLNVLAALRQNDE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccgcaggaaatcgtctcggtcctgaccgagtcccgcgtcttccccccgccc
gaggacttctcccggcgggcccacatccgcggcatgcaggactatcagcggctgtgggac
gaagccgcgaaggatccggacacgtactggggtgaccgggcccgcgaggagctctactgg
aaggttcccttccagacggtgctggactggaagccgccccacgcgcgctggttcgtcgag
gggaagaccaacctcgcctacaactgtctggaccggcacctgccgaagctccaggacaag
cccgccatcctcttcgagggcgagccgggcgaccgccggagcatcacctacggggagctg
tcccagcaggtgaaccggctggccaacggcctcaagtcgctgggcgtgaagaagggcgac
cgcgtgggcatctacctgcccatggtgccggaggccgccgtcgcgatgctggcgtgcgcg
cggctgggcgcggtgcactcggtggtgttcggcggcttctccgccgaggcgctccaggac
cgcatgaaggacgcgggcgcgaaggtgctgctcaccgcggacggcggctggcgcaagggc
gcggtggtgccgctgatgcggaacgtggaggccgcgctcccgaacgcccccagcatcgag
aaggtcgtcgtcctcacccgcaccggtgacggcaagctgcccgaaggtccgaagttcctg
gcctgggacgcgctggtgaagggccagtcggacgtctgcgagccggagtgggtggagagt
gaacacccgctgttcatcctctacacgtccggctccaccgggaagcccaagggcgtgctg
cacaccacggcgggctacgcggtgatggcgtcgctcaccacgcgctgggtgttcgacctg
cgcgacgacgacgtctactggtgcaccgcggacgtgggctgggtgacgggccactcgtac
gtcgtctacggcccgctgatgaacggcgtcaccaccatcatctacgagggcgcgcccacg
cagccggggccggaccgcttctgggacatcatcgagcgctacaaggccaccatcctctac
accgcgcccaccgccatccgcgccttcatgcgcctgggcgacgagccggtgaagaagcac
gacctgtcctcgctgcgcctgttgggcagcgtaggtgagcccatcaacccggaagcgtgg
atgtggtaccgcgaggtcatcggcggggggcgctgccccgtcgtggacacgtggtggcag
acggagacgggcagcatcatgatttcgccgctgcccggcgccacgcccaccaagcccgga
tccgcgacgttcccgctgcccggcatccacgcggagatcctggaccgcgaaggcaagcgc
gtgcccagggggcagggcgggctgctcttcgtgacgaagccctggccgtccatgctgcgc
accgtgtacggggacccggagcggtacgtgaacacgtacttcagcgagctgcccggcatg
tacttcaccggcgacggcgcgcgcacggacgcggacggctacgtgtggctgatggggcgc
gtggacgacgtggtgaacgtggcgggccaccgcctgggcaccgcggaggtggagagcgcg
ctcgtggcgcacccgaaggtgtccgaggccgccgtggtgggccgcccggatgacctgaag
ggcacggcgctcgtggccttcgtgacgctcaagcagggccaccctccctcggacgcgctc
aagaaggagctggccgtgcacgtgggcaaggagattggcgccatcgcgcggccggatgag
atccgcttcgcggaagggctgcccaagacgcgctccgggaagatcatgcgccggctgctg
cgcgacgtggccgcgggcaagcagtcctcgcaggacaccaccacgctggaggacctcaac
gtgctggcggcgctgcgccagaacgacgagtag

DBGET integrated database retrieval system