KEGG   Corallococcus coralloides: COCOR_05730Help
Entry
COCOR_05730       CDS       T01780                                 

Gene name
mauG1
Definition
di-heme cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ccx  Corallococcus coralloides
Brite
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     COCOR_05730 (mauG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7196001..7197149
Genome map
AA seq 382 aa AA seqDB search
MARRQAQAWKALATVALLAAGCADPSGPTEEPAPYDWKLPAGFPKPRVPEDNPMSEAKVQ
LGRRLFYDKRLSLNGTQSCGSCHEQARAFTDGRVHSVGSTGEAHRRNGQGLANVAYATSL
TWANSALTTLEAQSLVPLFGREPVELGFADQQEVLLERLRADPDLTARFAEAFPNEATPV
SLATLTRALSAFERSLISGTSAYDRYLYGKEVDALSPAAKRGLQLFLSERLECDHCHSGF
NFQDATVHEATAEPVLPYHNTGLYNEDGQGAYPAGDTGLFEITFRPEDMGRFRAPSLRNV
AVTGPYMHDGSLETLSDVLDHYAAGGRARAVNGGQPSPLQSAFVRGFELTPEEKADVIAF
LESLTDTAFLTDPRFADPATVP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgacgacaagcacaggcgtggaaggccctggcgacggtggcgttgctggccgcg
ggctgcgcggatccctcggggccgaccgaggagcccgcgccctacgactggaagctgccc
gcgggcttccccaagccgcgcgtgccggaggacaaccccatgtcggaggcgaaggtccag
ctgggccggcgcctcttctacgacaagcgcctgtcgttgaacggcacgcagtcctgcggc
tcctgtcatgagcaggcaagggccttcacggacgggcgcgtgcactcggtgggcagcacg
ggagaggcgcaccgccgcaacgggcaggggctggcgaacgtggcgtacgcgaccagcctg
acctgggccaactccgcgctcaccacgctggaggcccagtcgctggtgccgctgttcggg
cgggagccggtggagctggggttcgcggatcagcaggaggtgttgctggagcggctgcgc
gcggatccggacctgacggcccgtttcgcggaggccttcccgaacgaggccacgccggtg
tcgctggccacgctcacgcgggcgctgtccgcgttcgagcggtcgctcatctccggcacg
tcggcgtatgaccgctatctgtacggcaaggaggtggacgcgctgagtcccgcggcgaag
cggggcttgcagctgttcctgtccgagcgcctggagtgcgaccactgccactccggcttc
aacttccaggacgcgaccgtgcacgaggcgacggcggagccggtgctgccgtaccacaac
acggggctctacaacgaggacggccagggcgcgtatcccgccggggacacaggcctcttc
gaaatcacgttccgtccagaggacatggggcgcttccgcgcgccgtcgctgcgcaacgtg
gcggtcaccgggccgtacatgcacgatggcagcctggagacgctctccgacgtgttggac
cactacgcggcgggaggccgggccagggcggtgaacggcggacagccgagccccctgcag
agcgccttcgtgcgcggcttcgagctgacgcccgaggagaaggcggacgtcatcgcgttc
ctggagtcgctcacggacacggcgttcctgaccgacccacgcttcgcggaccccgccacc
gtgccgtga

DBGET integrated database retrieval system